KEGG   Pyrobaculum arsenaticum: Pars_0547Help
Entry
Pars_0547         CDS       T00503                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pars_0547
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0547
  Lipid metabolism
   00071 Fatty acid degradation
    Pars_0547
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pars_0547
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pars_0547
   00626 Naphthalene degradation
    Pars_0547
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pars_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(489883..490968)
Genome map
AA seq 361 aa AA seqDB search
MRAALLTEFNKPLEIKDVEVPKVGKGEVLLQVLACGICRSDWHLWRGDPSLVAYMQWSGG
KLPIIPGHEVAGRVVEVGEGVSNVEVGDVVVAPASSTGDNRTCRYCKEGASNICEHLWIP
GFGTHGCYAEYMKVPASSVVDLVKVPEGVPPEYAAITGCGFGTAWNALVVKNGIRPGETL
LITGAGGMGLSALLIASAAGAKTVVVDVNPASVEKAKKMGATAAYHYSGHPQELAKLVNE
EIVKSFGMVDAVFDSTGNPDVLSAVLPAVRPQGRILLAGLMMKGKEIWPLASDIVVAREL
TIQGVLMLPSQKYDGIFKLISEGRVNLEPVIYRRISLDEVNDAYAEMSRFKNAGRFVITK
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgctttattaactgaattcaacaagccgcttgaaattaaggacgtagaggtt
ccgaaggtaggcaagggggaggttttactacaagtactcgcgtgtggcatctgtagatcg
gactggcacctgtggaggggagatccctccttggtcgcgtatatgcagtggtcgggcggc
aaactgcccattatcccgggacatgaagtggcggggagggtggtcgaggtgggggagggg
gttagcaatgttgaagtgggagacgtagtggtggccccggcgtcgtcaacgggggataac
agaacttgtaggtactgcaaggagggggcttcgaacatatgcgaacacctttggattccg
ggcttcggcacacacggatgctacgctgaatatatgaaggtgccggccagctcggtagta
gacctcgttaaagtcccagaaggcgtcccgcctgaatacgcggctataaccgggtgcggt
ttcggcactgcgtggaacgccctagtggttaagaacggcattaggcctggcgaaacgcta
ttaataacgggagcggggggcatgggcctcagcgctttgttaatagcctctgccgccggg
gcgaaaaccgtcgtggtcgatgtaaaccccgcctcagtagaaaaggcgaagaaaatggga
gcaactgcggcatatcactactctggacatccccaggagctcgccaagctcgttaacgag
gagatcgtgaagtcttttggcatggtcgatgctgtgttcgattccacgggcaatcccgac
gtcctatccgcggtgttgccggcagtgcggccgcagggcaggatactgttggcggggctc
atgatgaagggcaaggagatctggccgctggcctccgatatagtagtcgccagagagttg
accatacaaggagtgttgatgctaccgtcgcagaaatacgacgggatatttaagcttata
tcggagggaagggtgaaccttgagcctgtgatctaccggaggatatctctcgatgaggtg
aacgacgcatacgccgagatgtcccgtttcaaaaacgccggcagatttgtaattactaaa
ttttaa

DBGET integrated database retrieval system