KEGG   Pyrobaculum arsenaticum: Pars_0622Help
Entry
Pars_0622         CDS       T00503                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_0622
   01230 Biosynthesis of amino acids
    Pars_0622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0622
   00051 Fructose and mannose metabolism
    Pars_0622
   00562 Inositol phosphate metabolism
    Pars_0622
Enzymes [BR:pas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pars_0622
Exosome [BR:pas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pars_0622
  Exosomal proteins of bladder cancer cells
   Pars_0622
  Exosomal proteins of melanoma cells
   Pars_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554593..555267
Genome map
AA seq 224 aa AA seqDB search
MKFPVLILNFKAYAEAAGRRAVEIAKAAERVAKELGVNIAVAPNHLELALVAQSVEIPVY
AQGVDVESPGAHTAHVALGNLKEAGAAGVILNHSEAPLRLNELARYVGKARELGLDVVVC
APDPTTSLAAAALGPHAVAVEPPELIGTGRAVSRYKPETVVQTVQLVAKHFADVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDHYQKIMELAKPLLK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccagtactaatcctgaacttcaaagcgtacgctgaggcggctgggcgcagg
gctgtggagatagcaaaggccgccgagagggttgcgaaggagctgggcgtcaatatcgcc
gtggcgcctaaccacctggagctggccctcgtagcacagagcgtggagatccccgtctac
gcccagggcgtcgacgtggagtcgccgggcgcccacacggcccacgtggcgctgggcaac
ttgaaagaggccggtgcggctggggttatcctaaaccacagcgaggcgcccctcaggctg
aacgaactggccagatacgtgggaaaggcgagggagttgggcctagacgtggtggtctgc
gccccggacccgacaaccagcttggcggcggccgccctgggcccccacgccgttgccgtg
gagccccccgagcttatcggcacggggcgggcagtctccaggtacaagccggagaccgta
gtccagaccgtacagctggtagcgaagcacttcgccgacgtggcggttattacaggcgcc
ggcatagagagcggcgaggatgtagaggcggccttaaggttgggaaccaggggcgtgctg
ttggcaagcgccgctgtcaaggcgaaggaccactaccagaagataatggagctcgcgaag
ccgcttctaaagtag

DBGET integrated database retrieval system