KEGG   Pyrobaculum arsenaticum: Pars_0626Help
Entry
Pars_0626         CDS       T00503                                 

Definition
30S ribosomal protein S6
Orthology
K02991  
small subunit ribosomal protein S6e
Organism
pas  Pyrobaculum arsenaticum
Pathway
Ribosome
Module
Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:pas00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pars_0626
Ribosome [BR:pas03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    Pars_0626
  Archaea
    Pars_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
556737..557183
Genome map
AA seq 148 aa AA seqDB search
MPTFKLVLSDPISGKAMQFEIKDPLAQRFVGLKIGDEIDGVILKDFISLPKGAKIKITGG
SGIEGAPMVPGVPGPVKRYILAEGPPGYRPKKRGMRRKKLVRGDTISDSIVQINAVIVYP
KDYSGPPAIPIGAKELEKLTKKEEAAAQ
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcctactttcaagctagtgctatcagatccaatcagcgggaaggcgatgcagttcgag
ataaaagatccgcttgcacagcgcttcgtcgggttgaaaataggagacgagatagacggc
gtaatactgaaggacttcatatcgctacccaaaggcgcaaagatcaaaataaccggcggt
agcggcatagagggcgcgcccatggtccccggcgtcccggggccagtcaagcgctacatc
ctcgcagagggcccgccgggctaccgcccaaagaagcggggaatgcgtaggaagaaactc
gtgaggggggacacaatcagcgactccatcgtgcagataaatgcggtgatcgtctatccc
aaagactacagcggcccgcccgcgattccgataggcgcaaaggagctggagaagttgaca
aaaaaggaggaggccgccgcccagtaa

DBGET integrated database retrieval system