KEGG   Pyrobaculum arsenaticum: Pars_0948Help
Entry
Pars_0948         CDS       T00503                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_0948
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0948
   00620 Pyruvate metabolism
    Pars_0948
   00640 Propanoate metabolism
    Pars_0948
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_0948
   00680 Methane metabolism
    Pars_0948
Enzymes [BR:pas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pars_0948
Lipid biosynthesis proteins [BR:pas01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pars_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(837576..839588)
Genome map
AA seq 670 aa AA seqDB search
MSLKSLEKETELPFDEYVLNDKWRHKYTPIDTYFKFHQQAIENLESFWESVAKELEWFKP
WDKVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPLDESGYPIDRRK
LTYYDLFREVNRVACMLKCNFGVKKGDRVTLYLPMVPELPITMLAAWRIGAITNVVFSGF
SADALAERINDSQSRIVITADGFWRRGKVVRLKEVVDSALEKAPGVENVIVLPRLGLKDV
PMTEGRDFWWNRLMQGIPPNTYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHV
YATMKWVFDIRDDDIYWCTADIGWVTGHSYVVLGPLLMGTTEIIYEGAPDYPQPDRWWSI
IERYGVTILYTSPTAIRMFMRYGEAWPGKHDLSTLRIIHSVGEPINPEAWRWAYRVLGNE
KVAFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFEVDVVDENGNPVPPGVKGY
LVIKKPWPGMLHGIWGDPERYVKTYWSRFPGMFYVGDYAIKDKDGYIWVLGRADEVIKVA
GHRLGTYELESAFVAHPAVAEAAVVGVPDAIKGEVPIAFVVLKQGVTPTEELRKELREHI
RKSIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKKAY
EELKAEMAGP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaaaagcttagaaaaagagaccgagctaccctttgatgaatatgtactgaac
gacaagtggcgccacaaatataccccaatagacacatatttcaaattccatcaacaagca
atagaaaacctggaaagtttctgggaaagtgtagctaaagaactagagtggtttaagcct
tgggacaaggtgctggacgcttctaacccgccgttttataagtggttcgttggaggtagg
cttaacctctcctaccttgccgtcgataggcatgtaaagacgtggcgtaagaacaaactg
gcaatagagtgggaaggcgaacctcttgatgagagcggatacccgatagatcgtagaaaa
ctgacgtactacgacctcttccgcgaggtgaaccgcgtggcttgtatgcttaaatgcaac
ttcggcgttaaaaaaggcgacagagtgacactgtacctcccaatggtgccggagctccct
attacgatgctcgccgcttggagaataggggctatcaccaacgtcgtattttcaggtttc
tccgccgacgctttagcagagcgcataaacgactcccaatcccgtattgtcataacagct
gacggattctggcgcagaggcaaagtggtaagactaaaagaagtagtagactcagcgctc
gaaaaagcgcctggtgtggaaaacgtcattgtgctacctagacttggactaaaggatgtg
ccaatgaccgagggccgcgacttctggtggaaccggctgatgcaaggcataccgcccaat
acctacatcgagcctgagcctgtggaaagcgagcacccgtcgttcatcctctacacatct
ggcactactgggaagcccaagggcattgttcacgacaccggtgggtgggctgtccacgtt
tatgccactatgaagtgggtatttgatattagagatgacgacatatactggtgcacagcg
gatattggctgggtgacggggcacagctacgtggtgttggggcctctgctcatgggcacc
actgagataatatacgagggcgcacccgactacccacagcccgacaggtggtggtctata
atagagcgctacggagtgacgatactatacacgtcgcccacggccatacgtatgtttatg
cgctacggcgaggcttggccggggaagcacgacttgtcaaccctccgcattatacacagc
gtcggcgagccgataaaccccgaggcgtggagatgggcctacagagttctcggcaacgag
aaggtggcctttggatctacttggtggatgacagagacaggcggcatagtgattagccac
gcgccgggcctctacctagtaccaatgaagccgggcacaaacggaccgccgctaccaggt
tttgaggttgatgtcgtagatgaaaacgggaacccagtcccccccggagtgaagggatac
ttggtcatcaagaagccgtggccaggcatgctccacggcatttggggcgaccccgagcgc
tatgtgaagacttactggtctaggttccctggcatgttctacgtcggcgactacgctatt
aaggacaaggacggctacatatgggtgttggggagggccgacgaggtgataaaggtagcc
ggccaccgcctcggtacctacgagctggagtcggccttcgttgcccaccccgccgtcgcc
gaggcggcggtggtaggagtgcccgacgccataaagggcgaagtacccattgcgtttgtc
gtgttgaagcagggggtaacccccaccgaagagctacgcaaggagttaagagaacacata
aggaagagcataggccccatagcggagccagcgcagatattcttcgtcactaagttgcct
aagacgcgctcaggcaagataatgcgccgtctgctaaaggctgtggctacaggcgctccg
ctgggcgacgtgacgaccctcgaggacgagacctctgttgaggaggcaaagaaggcgtac
gaagagctaaaggcggaaatggctggaccatga

DBGET integrated database retrieval system