KEGG   Pyrobaculum arsenaticum: Pars_0959Help
Entry
Pars_0959         CDS       T00503                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pars_0959
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pars_0959
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pars_0959
Enzymes [BR:pas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pars_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(850481..851476)
Genome map
AA seq 331 aa AA seqDB search
MWRYASMLPLKKGITLGEGATPLVKSNLAEGLYVKFEGANPTGSFKDRGMALGVTVAKES
GANKILVASTGNTAASAAAYAARAGMRCYVVLPRGNVARGKLMQAALHGAEIVMINGLFD
KALEYVVNYGTKYAYPLNSFNPWRLEGQKTVAFEIFEELGCPDYVVVPVGNAGNISAIWK
GFKELAELGLCNKLPRMVGVQAEGAAPLAEAWERGLEEPLFVDEPRTVATAIKIGRPINW
PKAVRAVKESGGFFIKVQDGEILKAQRELAQRDGIGAEPAGAASVAGFLKAKLRGVVVAV
VTGHALKDPDAVEISAKEVRNADELMELLEK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcgctacgcctctatgctcccgcttaaaaaaggcataactcttggcgaaggcgct
accccccttgtcaagtccaacttagcagaaggtctatacgtcaagttcgagggggctaac
cccaccggcagttttaaggatcggggcatggcgctcggagtcacagtggcaaaggagagc
ggcgcaaacaaaatactcgtcgcttcgaccggcaatacggccgcgtccgccgcagcctac
gccgccagggcggggatgaggtgttacgtagtgctccccaggggcaacgtggcaaggggg
aagctaatgcaagccgccctccacggggcggagatcgtgatgatcaacggcctcttcgac
aaggccctcgaatacgtggtaaactacggcactaagtacgcctaccccctaaacagcttc
aacccctggcgcctcgaggggcagaagactgtggcttttgaaatattcgaggagctcggt
tgccccgactacgtggttgtgccggtaggcaacgccggaaatatctcggccatctggaag
gggtttaaagaactggcggagctgggcttgtgcaacaagcttccgcggatggtgggcgtg
caggcagagggcgccgccccgcttgccgaggcgtgggagagggggctggaggagccccta
ttcgtcgacgagccgaggacggtggcgactgcgataaagatcgggagacctataaactgg
cccaaggcagttagggccgtgaaggagtcaggcggcttctttatcaaggtccaagacggc
gaaatcttaaaggcgcaacgagagctagcgcagagagacggaataggcgccgagcccgcc
ggggcggcctcggttgcaggttttttaaaggccaagttgaggggagtcgtggtcgccgtg
gtgacgggccacgccctaaaggaccccgacgcggtggagatatcggcaaaggaagttagg
aacgccgacgagctgatggagctgttggagaaatga

DBGET integrated database retrieval system