KEGG   Pyrobaculum arsenaticum: Pars_1214Help
Entry
Pars_1214         CDS       T00503                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pars_1214
Enzymes [BR:pas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pars_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1099825..1100670
Genome map
AA seq 281 aa AA seqDB search
MYKNSLFHSKEKYFIVLYISANMKWAVIITSGRPSKADLLARLVFKHGGEALYLPVVKVE
ERGADAQEVLEALAWSEAVLFMTGQSAWGLAEMLKRHSALEKAKEMLRSRVVVCRGSKAS
GNVKTQFGVECPNLGETIDEMMPKIGQYVSGKRLLVSFYGVVDSELLEKLRAVAGEVSYV
QTYSTVEAPEENALEAARRVAEGGYIIVFTSAVGASTFFAAAQRHGLLEKVVEALNSGRS
IAAVIGPVTEEEVKRWGVEKVVKPEKPFLAYLAEELAKLLK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaattccttatttcactccaaagagaaatattttatagttctgtatatctcc
gcgaacatgaagtgggcggtgatcatcacgtcgggccgcccctctaaggcagaccttctg
gcaaggttggtatttaaacacggcggggaggccctctacctgcccgttgttaaggtggaa
gaaaggggggcagatgcacaagaagttctggaggccttggcttggagcgaggctgttctt
tttatgacggggcagtccgcatggggccttgccgagatgttgaagagacacagcgcgttg
gagaaggccaaggaaatgctcaggtccagggtggtggtgtgcaggggaagcaaggcatct
ggcaacgtcaagactcagttcggcgtggagtgccccaacttaggcgagaccatcgatgag
atgatgccgaaaattggacaatacgtctcaggcaagaggctactagtgtccttttacggg
gtggtggacagcgagcttctcgaaaagttaagggctgtggccggggaggtgagctacgtg
cagacatacagcacagtggaggcgccggaggaaaacgcgttggaggcggcgaggcgggtg
gcggaggggggctacataatcgtcttcaccagcgcagtgggggcaagtaccttcttcgcc
gcggctcagcgccacggcctcttggagaaggtggtagaggcgctcaactctgggcgctcc
atagccgctgtcataggccctgtgacggaggaggaggtgaagaggtggggcgttgagaag
gtggtaaagcccgagaagcccttcttggcgtatctagcggaggagctagcgaagctcctc
aagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system