KEGG   Pyrobaculum arsenaticum: Pars_1215Help
Entry
Pars_1215         CDS       T00503                                 

Definition
(GenBank) uroporphyrinogen-III synthase (HemD), conjectural
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00860  Porphyrin and chlorophyll metabolism
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pars_1215
Enzymes [BR:pas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pars_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABP50783
UniProt: A4WK66
Position
complement(1100650..1101378)
Genome map
AA seq 242 aa AA seqDB search
MGLDNNFYIEAALICVKIVVTSGWAGEAFRKALRGAEVYVVPVLRLTPVEVDVKAVEEAV
AQSDLVVFVSGRAAYRLKELGAKLELTGKVVATAEGAKGAVMVKNAYGVEPQLVYDTSED
LAKALPGCRRGVVFHHGERAAELVEVLEVKCPVAEFYTYRAVPDEETIKSIPPADVYVFF
SALAAEAVGERRPELIKGALAVAAGPAVERALLRYGAVVRRPPRGRIGDVVEYVKRLLEE
LR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggggctagataacaatttttatattgaagccgcattgatctgcgtgaaaatcgtggta
accagtggctgggcgggagaggcttttcgaaaggcgttgcggggagccgaggtgtacgtg
gtccccgttcttaggctaacccccgtggaggttgatgtaaaggccgtggaggaggcggtg
gcacagagcgacttagtggtcttcgtctcggggagggcggcgtatcggctcaaggagctg
ggggcgaagttggagctgacgggcaaggtggtggcgacagctgagggggcaaagggcgcc
gtcatggtgaaaaacgcctacggcgttgagccgcagctggtctacgacacgtcggaggat
ttagccaaggccctgcctggatgtaggcgcggcgttgtcttccaccacggcgagagagcc
gccgagctggtagaggtgctggaggtcaagtgccccgttgccgagttttacacataccgg
gcggtcccagacgaggagaccattaagtccataccccccgccgatgtttacgtctttttc
agcgccctcgcggccgaggccgttggggagaggcggcctgagctcatcaagggcgccttg
gcggtggcggcgggcccagcggtggagagggccctcttgcgctacggggcagtagtgagg
aggcctccccgcgggaggataggagatgtggtggagtacgtcaagaggctacttgaggag
cttcgctag

DBGET integrated database retrieval system