KEGG   Pyrobaculum arsenaticum: Pars_1313Help
Entry
Pars_1313         CDS       T00503                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pas00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1185269..1186171)
Genome map
AA seq 300 aa AA seqDB search
MVIRGYLGSLPVGDVLPARVMAVINLSPESFYKGSVADEDPVERALCLERHADVIDVGAM
STAPYLETWVPPEKELERLKKALPEIIKSVKIPVSVDTYRPQVAEYALKVGASIINDVTG
GKLYPETCRIVADYGASVVLMAREREPRPGVDPITRVLDALRDSVTHFEKCGVDSGRIVV
DPGVGFPTLPPGDQPYVVKGEHRHGDPQWPWWKWDLYILSRLPSLRVLGKPILVGVSRKS
FLRKIAGVATPDEVLPASLAAEALAVYKGAHVIRTHNPAETRQVVRLAEALRSVELGKEV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcaggggatatctcggtagcctaccagttggcgacgtcttgccggcaagggtg
atggccgtaataaacctgtcacctgagtccttctacaaagggtcagttgcggacgaagac
cccgtagaaagggcgctatgcctcgagaggcacgcggacgtaatcgacgtgggggcaatg
tccacagcgccgtacctagagacttgggtccccccagaaaaggagctagagaggctcaag
aaggcactgccagagatcataaagtcggtaaaaatcccagtaagcgtcgacacttacagg
ccccaggtggctgaatacgcccttaaggttggcgcctctattataaacgacgtgaccggc
gggaagctctatccagagacgtgcagaatcgtggcggactacggcgcctcggtggtgctg
atggccagggaaagagagccgaggcctggcgtggacccaatcacccgcgtattagacgcc
ctgcgggactccgtaacccacttcgagaaatgcggcgtcgatagtggcaggatagtggta
gacccaggggtggggttccccaccctcccgccgggagatcagccgtatgtagtcaagggc
gaacaccggcacggcgacccccagtggccttggtggaaatgggacttgtacatattatcg
cgcctccccagcctccgcgtgttgggcaaacccatactagtcggcgtttctagaaagtcg
tttctccgtaaaatcgccggcgttgcgacccctgacgaggtcctgccggcgtcacttgcc
gcggaggccctagcggtgtacaaaggcgcccatgtaattaggacgcacaaccccgccgag
actaggcaggtggtaagactagccgaggctctgaggtcagtagaactcggcaaagaagtc
taa

DBGET integrated database retrieval system