KEGG   Pyrobaculum arsenaticum: Pars_1386Help
Entry
Pars_1386         CDS       T00503                                 

Definition
(RefSeq) AMP-dependent synthetase/ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_1386
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_1386
   00620 Pyruvate metabolism
    Pars_1386
   00640 Propanoate metabolism
    Pars_1386
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_1386
   00680 Methane metabolism
    Pars_1386
Enzymes [BR:pas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pars_1386
Lipid biosynthesis proteins [BR:pas01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pars_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1249553..1251517
Genome map
AA seq 654 aa AA seqDB search
MSSSQKFKAWEGLYNRWAEDPEGFWREFIEKTTHLIYWAKKPERIFQWQPPEPFKWFVGG
YTNAGYSAVDYKTGLLGEKIAYIYLNPEAGAERKVTYGELASYVYKFSAALRAAGVKKGD
TILVYMPNSIEAVAAILAAARVGAVSTTVFAGFSPKAVADRIELVEPKIVFTQDYSLRRG
RKIPLKANIDEAFKISAWRPSLVVVKKTEEGGDVPMEKGRDIWLEEFLEMGKGHSAHPEF
VESNEPLFVLPTSGTTAKPKPVVHVHGGYQVWIIYGALLVYGLSANDLIFNTSDIGWIVG
QSYIVFAPLIMGATSILFDGAIDYPKPDLFWEIVEKYKPTLIWTSPTAARLLMRYGTNLA
MKHDLSSVTRVVTAGEVLNPEVWRWLYEDVFRKRVPVIDHWWQTELAGPTIGYYYALVSG
MPHGLEHMEIKPGSAGVPLPGVEVEVVDERGNPVPPGHKGTLVIKRPHPGMTPTLWRDHQ
RYLNDYWGRYEGKLVYYTGDAAHMDEDGYIWFAGRADEVIKIAGHRIGTIEVESALVSHP
AVAEAAVVGVPDPLRGEAIAAFVVLRPGRQPTEDLKKDLIEHVRKTFGPIAVFAGVEFVN
MLPKTRSGKIMRRVLKRLWTGEPLGDLSTIEDEASIEEVKEAVSKMKFIKTAEF
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttctcaaaaattcaaagcatgggaggggctatacaataggtgggcagaagac
ccggagggcttttggcgcgagtttatagaaaagaccacgcaccttatctactgggctaaa
aagcccgagagaatttttcagtggcaaccccccgagcctttcaagtggtttgttggcggc
tacacaaatgcaggttacagcgcggtagattacaagacggggcttctaggcgagaagatt
gcctacatctacctaaaccccgaggcgggggcggagcggaaggtgacatacggcgaattg
gcgtcgtatgtctacaaattcagcgccgccctgagagctgccggggtgaagaagggggac
actatcctcgtctacatgcctaactcaattgaggctgttgcggctatactggctgcggcg
cgtgtaggagccgtctccaccaccgtctttgccggattttcaccgaaggcagtggccgat
aggatagagctggtagagcccaagatcgtattcacccaagactactcgctacgcagagga
agaaaaatcccgcttaaggcaaatatcgacgaggcgtttaagatatcagcgtggcggcca
tccctcgtggtggtaaagaagacggaggagggaggagatgtgccgatggaaaaggggcgg
gatatctggcttgaggagtttctcgaaatggggaagggccactcggcgcatcccgagttt
gtagagtccaacgagcccctcttcgtcttgcccacctcaggcaccacggcaaagcccaag
cccgtggtacacgtacatggaggctaccaggtatggatcatatacggcgctctgcttgtg
tacggcctctctgccaacgatcttattttcaacacaagcgacatcgggtggatcgtggga
cagagctatatagttttcgcgccgctgattatgggcgccacctctatcctattcgacggc
gctatagactaccccaagcccgacctattctgggagatcgtggagaagtacaagccgacg
ctgatttggacctcccccacggcggcgaggcttttgatgaggtacggcacgaacttggcc
atgaaacacgacctctcatcagtaacgcgggtagtcacggctggtgaggttctgaaccca
gaagtgtggcgctggctgtacgaggacgtgttcaggaagagggtgcccgtaatagaccac
tggtggcagaccgagctggcaggccccacaattgggtactactacgcccttgtaagcggc
atgccccacggccttgagcacatggagattaagccgggctccgccggcgtcccgctaccg
ggcgtcgaggtggaagtagtagacgagaggggcaacccggtgccgcctggccacaagggg
acgttggtgatcaaaaggccgcatcccggcatgacgccgacattgtggagggaccaccag
cggtatttaaacgactattggggcagatacgaggggaagttggtttactacacgggcgac
gcggctcacatggatgaagacggctacatctggttcgccgggagggccgatgaagtgatt
aaaatcgccggtcacaggataggcactatagaggtggagtcggccctcgtttcccaccca
gccgtcgcagaggcggctgtggtgggcgtcccagacccgctgaggggggaggcaattgcc
gccttcgtggtgctgaggccaggccggcaacccacagaggacctcaagaaggatctaatt
gaacatgtgaggaagaccttcggcccaattgcggtgttcgccggggtagagttcgtcaac
atgctccccaaaacccgttcggggaagataatgaggagggtgctcaagaggctgtggacc
ggcgagccgctaggagatctctcaacaatagaagacgaggcatcgatagaggaggttaag
gaggctgtctctaaaatgaagtttataaaaactgccgaattttaa

DBGET integrated database retrieval system