KEGG   Pyrobaculum arsenaticum: Pars_1418Help
Entry
Pars_1418         CDS       T00503                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pars_1418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pars_1418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pars_1418
Enzymes [BR:pas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pars_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1278824..1280053
Genome map
AA seq 409 aa AA seqDB search
MVDRWYNIAADLPAVLAPPKDPDEGESRIGLLTRILPSALIDQEFSAERWITVPEEVRDA
YRRVGRPTPLLRAEGLERALGTGVRIYYKYEGVLPVGSHKLNTALAQAYYAKADGAVEVA
TETGAGQWGMAVSLAAALFGLKAVVFMTRSSYNSKRQRLTFMRTYGATVYPSPSEVTEAG
RRHYRPDHPGSLGIAISEAVEYVLSGEKRHYLPGSVLEFVLMHQTVIGLEAVRQLPEEPD
AAVACVGGGSNFAGFTYPMIGMKLRGEGFDKTRFVAVEAEAAPKLTKGEYKYDFPDAVGI
LPMIKMYTLGHDYVPPPVHAAGLRYHGAAPSLSLLRKLGIVEPLSYPQEEVMKAAVLFAR
TEGIVPAPESAHAIRAVLDLAKKLPRGSVIAFNLSGHGLLDSDAYEKFL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggtagacaggtggtacaacatcgccgctgacctccccgctgtcttggctcctcccaaa
gacccagacgagggcgagagtagaatcggcctgcttacgagaatactcccatccgcgctt
atagaccaagaattttctgcagagcgctggattactgttccagaagaggttagagacgcg
taccggcgtgttggtaggccgacgcccctcctccgcgccgaggggctggagagggctctg
ggcacgggggtgaggatatactacaagtacgagggggtgctcccagtgggtagccacaag
ctcaacactgccctggcacaggcctactacgccaaggccgacggcgcggtggaagtggcc
accgagacgggggcggggcagtggggcatggctgtctccctcgcggctgctctcttcggc
ctaaaggcagtggtgtttatgacccgctcctcctacaactcaaagaggcagaggctgacc
tttatgaggacttacggcgcgacggtgtaccccagccccagcgaagtgacggaggcgggg
aggaggcattaccggccggaccacccaggctcgctggggatcgcaatatcggaggcagtg
gagtacgtcctatccggcgagaagaggcactaccttccgggcagcgtcttggagttcgtg
ctcatgcaccagaccgtcataggactagaggcggttaggcaactgccggaggagccggac
gccgccgtggcctgcgttggcggggggtcgaacttcgccggctttacctaccccatgatc
gggatgaagctgaggggcgagggcttcgacaagacgaggttcgtcgcagttgaggcggaa
gccgcccccaagctcacaaagggggagtacaaatacgacttcccagacgccgtggggata
ctccccatgatcaagatgtacaccttaggccacgactacgtcccgccgcccgtccacgcg
gccggcctccggtaccacggcgccgcgccgtccctctccttgcttcggaaattggggata
gtggagccgctctcctacccccaggaggaggtcatgaaagccgcagtgctcttcgcgagg
acggagggcattgtaccggcgccggagtcggcccacgcgataagggcagtgctagacctc
gcaaaaaagctcccgcgcggctcggtaatagcgttcaacctctccggccacggcctcctc
gactccgacgcctacgagaagttcctgtaa

DBGET integrated database retrieval system