KEGG   Pyrobaculum arsenaticum: Pars_1422Help
Entry
Pars_1422         CDS       T00503                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00260  Glycine, serine and threonine metabolism
pas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01130  Biosynthesis of antibiotics
pas01230  Biosynthesis of amino acids
Module
pas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pars_1422
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pars_1422
Enzymes [BR:pas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pars_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE IGPS IMPDH PcrB ThiG FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABP50980
UniProt: A4WKR3
Position
1282931..1283638
Genome map
AA seq 235 aa AA seqDB search
MLRRPGLGVYLLAGWPSEKTYREAVAGMDGLVDFFELGIPSPNPKYDGPFIRRAHREVSA
PVWDKPSAPTYLMGYWEDARGRPADLFERAASLGARGVLLPDLLIDFPEELDTYLKLTRE
YGLAPVFFLPSKFPYALAKRLAASKPDFIYIGLYAATGIELPVYVERNVKILRELAPDVY
IVAGFAVDSPAKAAKLVRAGADGIVVGTAFMRRLQKDVREALAFLAEVKKALLDL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaggccgggcctcggggtttacttgctagccggctggcccagcgaaaagacg
tacagagaggcggtggccgggatggacgggttggtggacttcttcgagctggggatcccc
agccccaacccgaaatacgacggaccgtttataaggagagctcacagagaggtgtcggcg
ccggtgtgggataagcctagcgcccccacctacctgatggggtattgggaagatgcccgc
ggccggcccgcagacctttttgagagggccgcctcgctgggagcgaggggggtgctactg
ccggacttgctcatagacttccccgaggagctcgatacctacctcaagctgacgcgggaa
tacggcctcgcccccgtgttcttcctccccagcaaattcccctacgccttggcgaagagg
ttggccgcctccaagcccgacttcatatacatcggcctatacgccgccacgggcatagag
ctaccggtatacgtggagcgcaacgtgaagatcctgagggagctagcccccgacgtctac
atcgtggcgggattcgccgtggacagcccagccaaggcggcgaagctggtgagggccggc
gcagacggcatagtcgtggggacggccttcatgcgcaggttgcagaaggacgtgagggag
gcattggccttcttggcagaggttaaaaaagcgcttctcgacctctga

DBGET integrated database retrieval system