KEGG   Pyrobaculum arsenaticum: Pars_1481Help
Entry
Pars_1481         CDS       T00503                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pas00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339311..1340114
Genome map
AA seq 267 aa AA seqDB search
MCDNSASSSVVFVGIPWDGAVAGRPGARLGPAKIRTAFCNLPKRADVEDLGDVDVVIGDP
AETWQRVEKTFRSLKDRQQILVAGGDHSVTPYVYRGLSEGRKISYVVLDAHFDLRTVSEG
LTSGMATRLVKESGGDIPITVIGIREWSNPSYMFSLADKMGIEYYTIEQIHKLGIEEVAD
RVYQQHRNYKAYLSIDLDVVDPAFAPGVNAPSPGGLTSREVLILVSHLSKALKPIAVDTV
EVSPPYDVGDITSNLAAVLLYTSIWSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaattctgcctcttcctcggttgtatttgtaggtattccatgggatggcgcc
gtggctgggagacccggcgcccgcttaggtccggcaaaaattagaacagctttttgcaac
cttcccaaacgcgccgatgtagaagacctaggagatgtagatgtggttataggcgatcca
gcagagacttggcagagagtagagaagacctttagatctctaaaagatcggcaacaaatt
ctcgtcgccggaggagaccactctgtgacgccctatgtttatcgcggcttatcagaaggg
agaaaaatcagctacgtagtcctcgacgcccattttgatcttagaacagtttctgaaggt
cttaccagcggcatggctacgcgattagtaaaggaatcaggtggtgatatccccatcacg
gtaattggaataagagagtggtcaaacccctcgtacatgttttctctagccgataagatg
ggaattgagtattacactattgaacagatacacaaactcggcatagaggaagtcgccgat
agagtttaccaacagcatagaaattacaaagcttatctgagcatagacctagacgttgtc
gatcccgcttttgcgcctggcgtcaacgccccaagccccggcgggttaacttctagagaa
gtcttaatactggtatcacatctcagcaaagcgctaaaacccattgcagtagatacagtc
gaggtttcgcctccttacgacgtcggcgacatcacctccaacctagccgccgtattgtta
tatacgtccatatggagccggtag

DBGET integrated database retrieval system