KEGG   Pyrobaculum arsenaticum: Pars_1529Help
Entry
Pars_1529         CDS       T00503                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_1529
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pars_1529
   00640 Propanoate metabolism
    Pars_1529
   00660 C5-Branched dibasic acid metabolism
    Pars_1529
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_1529
Enzymes [BR:pas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pars_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1387091..1388239
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFSKYGVKIPPGRVATTPEEVRKIAEEIGGPVVLKAQVVVAGRGKAGGIK
VAKTPEEAYELATKMFGMNIKGLVVKKIYVTKYVEVEREMYLSLIIDRATRRYLFLASPI
GGVDIEEIAKTQPEKIKRVYVDPSVGLRDYHVRSIVLWLGFKPETPQWRQASSIVQAMYN
IMVDYDAELVESNPLAVTREGDVIPLDARVIVDDNALYKHPELEKALEEDPRDVSEFEMY
AKKIGFHYVELDGDVGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASRDVVKEALKV
LLRHPRVKVIFMNIFGGITRADEVAAGVEAALAEEGGTKKKIVVRMKGTNEELGRQMLAK
LGIPLYENAEEAAQKAVELARA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaatatgaggctaaggagcttttttctaaatacggcgtcaagatcccg
cctgggagggtggcgactacgccggaggaggttcggaagatcgcagaggagatcggcggc
ccggtggtactgaaggcgcaggtggtggtagctggccggggcaaggcggggggtataaaa
gttgcgaaaacgccggaggaggcctacgagctcgccacaaagatgttcggcatgaatatt
aaggggctagtcgtgaagaagatctacgtgactaagtatgtcgaggtggagcgagagatg
tacctctcgctgattattgacagggctacgcggaggtacttattcctcgcatcccccata
ggcggggtggatattgaggagattgcgaagacacagccggagaaaataaagcgcgtctac
gtcgacccatcggtggggcttagggattaccacgtccgttctattgtcctgtggctcggc
tttaagccggagacgccacagtggcggcaggcgtcgtctatagtacaggcgatgtacaac
ataatggttgactacgatgcggagctcgtagagtccaaccccctggccgtcacaagggag
ggggatgtcattcccctagacgccagggtaatagtcgacgacaacgccttgtataaacac
cccgagctggaaaaggcgctggaggaggacccccgcgacgtctccgagttcgagatgtac
gcaaagaagatcggcttccactacgtcgagctcgacggcgacgtgggaataatcggaaac
ggcgccgggctgaccatggctaccatggacttggtctaccacttcggggggagacctgcc
aatttcttagacatcggcggcggggcatcgcgcgatgttgttaaagaggcgttaaaggtg
cttctgagacacccccgggtgaaggttatttttatgaatatattcggcggcattactagg
gcagacgaggttgcggccggcgtagaggcggcgttggccgaggagggtgggacgaaaaag
aagatcgttgtgaggatgaaaggcaccaacgaggagctggggaggcagatgttggccaag
ttaggtataccgctatatgaaaacgccgaggaggccgcacaaaaagcagtagagttagcg
agggcatga

DBGET integrated database retrieval system