KEGG   Pyrobaculum arsenaticum: Pars_1546Help
Entry
Pars_1546         CDS       T00503                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pas01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pas00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1401880..1403079
Genome map
AA seq 399 aa AA seqDB search
MESKAVSILSKLVSIPTVNPPGEKYGELIDYAERFFKSLGLDTEVVEVPKAEVAMRCPEC
ADYPRLILIARSGEPKIHFNGHYDVVPPGPLESWKVTKPFEPVYQNGRLYGRGAVDMKGG
LTSIMLAVEKAVSTGLGGFEVSFVPDEETGGETGAGYLARSGRIKAPWVVIAEGSGEDNI
WIGHRGLVWFLVEVYGKQAHGSTPWLGLNAFEGAAYIAYRLQEYAKRVAAKVSKYEYDDP
RGASPTVTIGGEVRGSVKTNVVPGYFAFSVDRRVIPEEDLEQVKREFLEFVQQVAKELPH
RVEVKVTNVSEAALVEPEHPLVKALSEAVEKTIGQRPRKTVCVGGLDARFFVKAGIPTVT
YGPGPIGLAHAPDEYVEIRQVVHVAEAYYNLIKQVSGGR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagtctaaggcagtttctatcctaagtaagttggtatctatccccacagtaaatccg
cctggggagaaatacggcgagcttattgattatgcggagaggtttttcaaatctcttgga
ctggacaccgaagttgtagaggttcccaaggccgaggtggcgatgcgctgtcctgaatgc
gccgactacccccgcctaattttaatagcgcgaagcggcgagccgaagatacatttcaat
gggcactacgacgtggtccctcccggccctcttgagagctggaaggtgacaaagccgttt
gagcccgtctaccaaaacggccggctatacggcagaggcgctgttgacatgaagggaggc
ctcacgtctataatgctggcggtagaaaaggccgtgtctaccgggctaggtggttttgaa
gtgtcttttgtgcctgacgaggagacgggcggcgagacgggggccggttatttggctagg
tctgggaggataaaggcgccttgggtggtgatagcagaggggtcgggggaggacaacatc
tggataggacacagaggtctggtgtggtttctggtggaggtatacggcaagcaggcccat
ggctctacgccgtggcttggcctaaacgcatttgaaggcgccgcctacatagcatatagg
ttgcaggaatacgccaagagagttgccgccaaggttagcaaatatgagtacgacgacccg
cggggggcctctcccacagtgaccatagggggggaggttaggggctctgtaaagacgaac
gtcgtaccgggctacttcgcgttttccgtagacaggagggtaatacctgaagaggactta
gagcaggttaaaagggagttcctggagtttgtacaacaagtcgctaaggagttgccgcac
agagtggaggtcaaggtgacgaacgtatctgaggccgccctcgttgagcctgaacacccg
ttagtaaaggctctttctgaagcagtggaaaagactataggacagaggcctaggaagacg
gtgtgcgtaggcggcctagacgccaggttttttgtcaaggcggggattcccacagtcacc
tacggccccggccccattggcctagcacatgcacccgatgagtatgtagaaatccgccag
gtggtgcatgtggccgaggcatactacaacctaataaaacaagtaagcggagggcgctaa

DBGET integrated database retrieval system