KEGG   Pyrobaculum arsenaticum: Pars_1708Help
Entry
Pars_1708         CDS       T00503                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:pas01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pas00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pas00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pas00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pas00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pas00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pas00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pas00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:pas00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1542553..1543101
Genome map
AA seq 182 aa AA seqDB search
MFEAVFLGRGGQGAVTAVQLLAYAAALEGKKAQALPEFGAERRGAIVRAYLRVGDVLLHS
SVKKADYVVVLDGRIVEQIDVRQYGKPGAVYIVNSKTPADWYIAIDATSIALKHGLVVAG
WPVVNLIMAAALAAVSGLVSLDSIVKAIPEYVPKRFVESNIKAVVEGYEVAKRSLRPAPS
VD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgaggcagtgtttctgggtcggggaggacaaggggcggtgactgctgtccaactt
ctcgcctatgccgcagccctggaggggaagaaggcacaggcgttgcccgagttcggcgca
gagaggagaggggccatagtgagggcctacctcagagtgggggatgtgcttctacattct
tcggtgaaaaaggcggattatgtggtggtgctggacgggcgtattgtcgagcagatcgat
gtgaggcaatacggcaagccgggagccgtgtatatagtgaacagcaagacgccggcggat
tggtacatagccatagacgccacctccattgcgttgaagcacggccttgttgtggctggg
tggcctgtggttaatctaataatggcagcggcgctagctgctgtgagtgggctagtttct
ctagacagcatcgtgaaggcgattccagaatacgtacctaagcgatttgtcgagagtaac
ataaaggccgtggtggagggctacgaggttgctaagaggagcttaaggccagcgccctcc
gtcgattga

DBGET integrated database retrieval system