KEGG   Pyrobaculum arsenaticum: Pars_1872Help
Entry
Pars_1872         CDS       T00503                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_1872
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_1872
   00052 Galactose metabolism
    Pars_1872
   00500 Starch and sucrose metabolism
    Pars_1872
   00520 Amino sugar and nucleotide sugar metabolism
    Pars_1872
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pars_1872
   00524 Butirosin and neomycin biosynthesis
    Pars_1872
Enzymes [BR:pas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pars_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1676234..1677124
Genome map
AA seq 296 aa AA seqDB search
MPLYLGVDVGATWTRAVLVDDHANVVNRLKIRTSKNPLADVAEAVAGWKFDSIGVGSIGP
MDLRSGWVTNSPNSPARQFPLVEPLKKLSKPVVVANDCVAAVWGEYVFKHGVDNMVYLTL
STGVGVGAVVNGTLLLGKDGNAHELGHAVIDFRAGRQCGCGGFGHFEAYIGGANVPKWFR
EVSGEAVADAAEVFSRYRAGDSKAVEFVNLWLDALAAGIATVVAAYDPELLIVGGSVALN
NWDIIIPKLSPRLAKYLGVRPPKILQASFGDDEVAIGAAALAYKTPDSLKKFGYPR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtatctaggcgttgatgtgggagcgacgtggacgagggccgtattggtggat
gaccatgcaaatgtggtaaacaggttgaaaattagaaccagtaaaaacccccttgccgac
gtcgccgaggcagtagcggggtggaagtttgacagtataggcgtgggatccatcgggcct
atggacttgagaagcggatgggttactaactcgcctaattctccagctaggcagttccca
ctagtcgagccgttgaaaaaactgagcaaaccagtagttgttgcaaacgactgcgtcgca
gcagtgtggggagagtatgtctttaaacacggcgtcgacaacatggtgtacttaactctg
tccactggcgttggggttggcgcagtggttaacggcactctactgctgggcaaagacggc
aacgctcacgaactgggacacgccgtgatagatttccgtgcgggtcgccagtgcggatgc
ggcggctttggccacttcgaggcatatattggtggggcgaatgtgcccaagtggttccgc
gaagtctccggcgaggcggtagcagacgccgccgaggtgttcagtagatatagagctggg
gattcaaaggcggtggagtttgtcaacctctggctcgacgccttggccgcgggcatagcc
acagtggtggcggcctacgaccccgagctgttgatagtggggggatcagtcgccttgaac
aactgggatatcataatccccaagctttccccgcgtttggcgaaatacttaggcgtgcgg
cctcccaaaattctccaggcatcttttggagacgacgaagtggcgataggcgccgccgcc
ctcgcttataaaaccccagatagcttgaaaaagttcggatatcctagatag

DBGET integrated database retrieval system