KEGG   Pyrobaculum arsenaticum: Pars_1947Help
Entry
Pars_1947         CDS       T00503                                 

Definition
radical SAM domain-containing protein
Orthology
K04070  
putative pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
pas  Pyrobaculum arsenaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1747171..1748289)
Genome map
AA seq 372 aa AA seqDB search
MWALYRPDALAVWQNPVVRERLKWYYLVMRDEAPAKYHIAARIEAPADYRLLGDSELWKL
HDKLGKAFDDEWSRQKERPDPSLAKKELPQASFLDVKTELARRQLKRCILCERRCGVDRT
SRRGACLLDAKPRVASFFHHLGEEAPLVPSGTIFFAGCNFRCVYCQNWDISQDPEAGAEA
SPEALAAIQVRLREEGARNINWVGGEPTPNIPFILESLRILARRGVNVPQLWNSNMYLTP
EGLALILHVMDIWLPDFKYGNDACALRYSVAPRYWEVTTRNFSVICSRGEDIIVRHLVLP
GHVDCCTKPVLRWLAENCKHALVNIMDQYRPEHLVVKLDRYREIRRRVSQKEMDEAYMYA
DSLGLAWREVSR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggctttgtataggccagatgccttggccgtgtggcagaatcccgtggtaagggag
cggttgaagtggtattacttagtcatgcgcgatgaggcgccggccaagtaccacatagcc
gcaaggattgaggcgccggccgactatagattactgggggatagcgaattgtggaagttg
cacgacaagctgggaaaagcgtttgatgatgagtggagccgccagaaggagagacctgac
ccgtctctggcgaaaaaggagctaccacaagcgtcttttctcgacgtcaagacagagctg
gcgaggaggcaattaaagcgctgtattttgtgcgagcggcgttgcggcgtggacaggacc
tcccggcggggcgcgtgcctcctcgacgccaagccccgcgtggcgagcttcttccaccac
ctaggggaggaggcccctctagtcccgtctgggactatcttctttgcgggttgtaacttc
aggtgcgtctactgccagaactgggatatctcacaagatcccgaggccggcgcagaggcc
tcgccggaggccctagccgcaattcaggttaggctcagggaagagggggcgcgcaatata
aactgggtgggcggcgagccgacgccgaatataccatttatccttgagtcgttgagaata
ttggcaagacgcggagtaaatgtcccccagctgtggaactccaacatgtacctaacgccg
gagggtttggccctgatactccacgttatggacatatggctccccgactttaagtacggc
aacgacgcatgcgccttgaggtactcggtggccccccgctactgggaggtgacgacgagg
aatttttccgttatatgcagtaggggagaggatatcatagtccgccacttggtgctcccg
gggcacgtcgattgttgcacaaagccagtgctgaggtggcttgcagagaactgtaaacac
gccttagttaatatcatggatcagtacaggcccgagcacctcgtggttaagctagatcgc
tatagggagattaggcgtagggtttcccaaaaggagatggacgaggcatatatgtacgcg
gactctcttggcttggcgtggcgcgaggttagccggtag

DBGET integrated database retrieval system