KEGG   Pyrobaculum arsenaticum: Pars_1969Help
Entry
Pars_1969         CDS       T00503                                 

Definition
glycosyl transferase family protein
Orthology
K01001  
UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Metabolic pathways
Brite
Enzymes [BR:pas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     Pars_1969
Glycosyltransferases [BR:pas01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   Pars_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1765092..1766051)
Genome map
AA seq 319 aa AA seqDB search
MFAEIVSAVAAFIAGVVFGLWWVGEQKRRNITSRDIYKNISGVPRAGGLIAMVAATVGYS
LLSTITDKSLLVLVISMIMGILGLVDDLKGLSEYVRVLVPVVLAFALARTSMITLTVPMV
GLFYGATGWLSVLAIPVLTNAFNMLDPVNGFLPMANTIVGLSLAAVAAMRGQWDAVYLLA
VHAAASLSLYVHNRYPAKTFNGNVGSYFLGASISTIAVLYDLVPYLILAGLPFVVNGALI
IFSSGGIKGREKIERPTYLENGLVYQQCNSPIISLVRLTVANGPMNEYGIFKALTVLTAT
TSALTVATTAVIHIFSLPI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgaaatcgtgtctgccgtcgccgcttttatagccggtgttgtttttggcttg
tggtgggtaggcgagcagaaaaggcgcaacatcacatcccgtgatatatacaagaatatt
agtggagtgcctagagccggggggctaatagcaatggtggctgcaactgtggggtatagc
ctcttgtcaacaattacggataagtcgttgctagttctggtgatatcgatgattatgggg
atcttggggctagttgacgacttgaaagggcttagcgaatacgtaagggtgctagtcccg
gtggtcttagcatttgcgctagcccggacaagtatgataacgcttactgtgccgatggta
ggtcttttctatggggcaactggttggctctctgtcttggcaattcccgtattgacaaat
gcctttaacatgcttgacccggtaaacggctttcttcccatggcaaacaccatagttggc
ctctccctagccgcggtagccgctatgaggggacagtgggacgccgtctatttgttggcg
gttcatgcggcggcttccctttcgctgtatgtgcacaacagataccccgccaagaccttc
aacggtaatgtcggtagctacttcttgggagctagcatctctacaatagcagtactctac
gacttagtcccttatctgatactagctggtcttccctttgttgtaaacggggcgttgata
atattctcctcaggcgggattaagggacgggaaaaaattgagaggcctacctatttggaa
aacggcctcgtgtaccaacaatgcaactcacctattatttccctggttaggttaactgta
gccaacgggcctatgaacgagtacggaattttcaaggcgctgacggtgctgacggcgacg
acctcggcattaacagtagcaaccacagcagtcatacacatcttttctttacccatatga

DBGET integrated database retrieval system