KEGG   Pyrobaculum arsenaticum: Pars_2240Help
Entry
Pars_2240         CDS       T00503                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pas01100  Metabolic pathways
pas01110  Biosynthesis of secondary metabolites
pas01130  Biosynthesis of antibiotics
pas01230  Biosynthesis of amino acids
Module
pas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pars_2240
Enzymes [BR:pas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pars_2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh Ferritin Dus ThiG
Motif
Other DBs
NCBI-ProteinID: ABP51786
UniProt: A4WN19
Position
complement(2007974..2008723)
Genome map
AA seq 249 aa AA seqDB search
MDFLAQVKKAVELRLATEPSPPARSLPLVDFSKALGEFGIIAEYKRASPRGVVRLDMPPW
AYFAMLQPYAAAFSVLTEPYWFLGDYRFITMAKPFKPVLMKDFVIDNRQIDMAYGYGADA
VLIIYRLVGREKAMELAEYAQRLGLTPVVEVDNLQDAKEAATWGGKVMLGINARDLATLE
VSLQKAFEIAKALRGDVDFIIESGISKPEEVEKACMLYARGVLVGTALMKNPALIKELRH
AAESCVSRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcctggcccaggttaaaaaggccgtggagctccgcctcgccaccgagccgagt
ccccccgcgaggtcgttgcctcttgtcgatttctcgaaggcactcggcgaatttggaata
attgccgagtacaagagagcgtcgccgcggggggttgtacgtcttgacatgccgccgtgg
gcctacttcgccatgcttcagccctatgcggccgcgttttcggtacttacagagccctac
tggtttcttggcgactaccgctttatcaccatggctaagccctttaagcccgtgctcatg
aaagacttcgtcatagacaataggcagatcgacatggcgtacggatacggcgccgacgcc
gtcttaataatctaccgcctagtgggaagggagaaggccatggagctcgcggagtacgcc
cagcggcttggcttgacgccggtggtggaggtagacaacctccaagatgccaaggaggcc
gccacgtggggaggcaaggtcatgttaggcataaacgccagggacttagccacgctggag
gtgagcctccagaaggcgtttgagatcgctaaggcgttgcggggtgacgtcgactttata
atagagagcggcatatcgaagccggaggaggtggagaaggcatgtatgctatacgcaagg
ggagtcctcgtcgggacagccctaatgaaaaaccctgcattaataaaggaacttaggcac
gccgccgagtcgtgtgtctcacggcggtga

DBGET integrated database retrieval system