KEGG   Pyrobaculum arsenaticum: Pars_2278Help
Entry
Pars_2278         CDS       T00503                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_2278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_2278
   00020 Citrate cycle (TCA cycle)
    Pars_2278
   00620 Pyruvate metabolism
    Pars_2278
   00640 Propanoate metabolism
    Pars_2278
   00650 Butanoate metabolism
    Pars_2278
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_2278
   00680 Methane metabolism
    Pars_2278
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pars_2278
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pars_2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2039110..2040318)
Genome map
AA seq 402 aa AA seqDB search
MSAQLIREKEKIIKQKRIALTGNHAVALAVKMARAEVIAAYPITPQTPVVEKLAEYVNNG
ELDAEYIPVEAEHSAMSAVIGASAMGARTFTETSSQGLGHMYENLPIAVGMRLPIIMGMA
VRTYSAPINVWGDYSDVMSMRELGWIIYITQNAQEAFDTIIQAYRVAEDSRVHLPAVVAY
DGFWTSHVLQPLDVPEDEEEVIRFAPITRSWVKLDLDNPAQLGAVGTPEWYWEIRWQAVE
ALRGSTKVIEEVDNEFGRRFGRRYGLVSPYMLDDAEIAIVTYGSVYGLVKKAVNKLRSEG
VRAGALRLRVIRPWPGDLIAKYLGNVDKIMVIDRTINHGGPLYGPMATEIATTVQRPVYN
VLATIGMRAIDSDMIYEAAMKVYRGLWAPGVPYTVGLRGGYE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagttaattagagaaaaagaaaagattataaagcagaagcgcatagcgctt
actggaaaccacgcggtggcgttggccgtgaagatggccagggccgaggttatcgccgcc
tatcccatcacgccgcagacgcccgtcgtggagaaactcgccgagtatgtcaacaacggg
gagctggacgcagagtacatcccagtggaggcggagcactctgccatgtcggctgttatc
ggcgcctcggcgatgggggcccggacgtttactgagacgtcgtctcaaggactgggccat
atgtacgagaacctcccaattgcggtgggtatgaggttgcccattatcatggggatggcc
gtgaggacatactctgctcctatcaacgtctggggggactacagcgacgtgatgtctatg
agggagctggggtggataatatacatcacgcagaacgcacaggaggccttcgatacaatt
atacaggcataccgcgtagctgaggactcgcgggttcatctgccagctgtggtggcctac
gacgggttctggacgtctcacgtcctccagccgctggacgttccggaggacgaggaggag
gtgattaggttcgccccaatcacgaggagctgggttaagctcgacctggacaacccggct
cagctgggcgccgtgggtacgcctgagtggtattgggagatccgctggcaggctgtggag
gcgcttagggggtcgacaaaggtgatagaggaagtcgacaatgagttcgggaggaggttc
gggaggaggtacggccttgttagcccctacatgctggatgacgccgagatagccatagtg
acgtacggctctgtttacggcctcgtcaagaaggctgtgaataagcttaggtctgagggg
gtgagggcgggggcgcttaggctgagggtaattaggccgtggcccggcgacctcatagcg
aagtatttgggcaacgtggataaaataatggtgattgaccgcacgattaaccacggcggc
ccgctctatggcccaatggcgacggagatagctaccacagtgcagagacctgtctacaac
gttctggccactatagggatgagggctatagacagcgacatgatctacgaggcagcgatg
aaggtatacagaggtctgtgggcgcccggcgtgccgtatacagtgggcctaaggggcggc
tatgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system