KEGG   Pyrobaculum arsenaticum: Pars_2279Help
Entry
Pars_2279         CDS       T00503                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit / pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00010  Glycolysis / Gluconeogenesis
pas00020  Citrate cycle (TCA cycle)
pas00620  Pyruvate metabolism
pas00633  Nitrotoluene degradation
pas00640  Propanoate metabolism
pas00650  Butanoate metabolism
pas00680  Methane metabolism
pas00720  Carbon fixation pathways in prokaryotes
pas01100  Metabolic pathways
pas01120  Microbial metabolism in diverse environments
pas01130  Biosynthesis of antibiotics
pas01200  Carbon metabolism
Module
pas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_2279
   00020 Citrate cycle (TCA cycle)
    Pars_2279
   00620 Pyruvate metabolism
    Pars_2279
   00640 Propanoate metabolism
    Pars_2279
   00650 Butanoate metabolism
    Pars_2279
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_2279
   00680 Methane metabolism
    Pars_2279
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pars_2279
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pars_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_2 Fer4_8 Fer4_17 Fer4_15 Fer4_13 Fer4_4 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABP51823
UniProt: A4WN56
Position
complement(2040315..2041253)
Genome map
AA seq 312 aa AA seqDB search
MRIETVWVGRGGQGIVTATYIIANASIIDGFHAIANPEFGAERRGAPVKAFLTISKEPIE
DQEPVKTPHVAVVFDDKLLGAMQFVIDAVKPGGYVILNTGKSPQDAAALVGRDDVNIVVI
DAIAIARKHLKLDVPNGPLAGAFSKVMGFPSLQSIREAFETQLGKAVEENFAAVKEAYEV
AAVIPAKKVDASAKPKGIISTTSAFLTGPYEVVGWREVNKAGAVFPGSSFPYATGGWRID
KPVIDHSKCIMCRKCWLYCPDDAIIEAWVEREGPRGRKFRMKMIDFDYQYCKGCGVCAEV
CPTGAIQMVREI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaatcgaaacagtctgggtaggccgcggaggccagggcattgtcacagctacttat
attatcgcaaatgcgtctattatagacggctttcacgcaatagccaatcccgagttcggg
gccgagcgcaggggagcgccggtcaaggccttcctaacaataagcaaagagcccatagaa
gaccaagagccggtcaaaaccccccacgtcgcggtggtattcgacgacaagttactcggc
gctatgcagttcgtcatagacgcggtgaagccggggggctacgtcatattgaacaccgga
aagagcccgcaagatgcagcggctcttgtgggaagagacgacgtaaacatagtggtgatc
gacgccatagccatcgccaggaagcacctcaagctagacgtccccaacgggcccctagcg
ggagcattctccaaggtgatggggttcccaagcctccagtctattagagaggccttcgag
acgcaactaggcaaggccgtggaggagaacttcgccgcggtcaaagaggcctacgaagtc
gccgcagtgataccagccaagaaagtagacgcctcggccaagcccaagggcataatctca
actacgtcggccttcctaactgggccctacgaagtcgtgggctggcgcgaggtgaacaaa
gccggtgcggtgttccccggatcaagcttcccctacgccacgggcggctggcgtatagat
aagccggttatagaccactccaagtgcatcatgtgcaggaagtgctggctctactgcccc
gacgacgcgatcatagaggcttgggtggagagggaggggccgaggggtaggaagttccgc
atgaagatgatagacttcgactaccagtactgtaagggttgtggcgtctgcgcagaagtt
tgtccaactggggcaatacaaatggtgagggagatatga

DBGET integrated database retrieval system