KEGG   Pyrobaculum arsenaticum: Pars_2279Help
Entry
Pars_2279         CDS       T00503                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma/delta
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_2279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_2279
   00020 Citrate cycle (TCA cycle)
    Pars_2279
   00620 Pyruvate metabolism
    Pars_2279
   00640 Propanoate metabolism
    Pars_2279
   00650 Butanoate metabolism
    Pars_2279
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_2279
   00680 Methane metabolism
    Pars_2279
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pars_2279
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pars_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2040315..2041253)
Genome map
AA seq 312 aa AA seqDB search
MRIETVWVGRGGQGIVTATYIIANASIIDGFHAIANPEFGAERRGAPVKAFLTISKEPIE
DQEPVKTPHVAVVFDDKLLGAMQFVIDAVKPGGYVILNTGKSPQDAAALVGRDDVNIVVI
DAIAIARKHLKLDVPNGPLAGAFSKVMGFPSLQSIREAFETQLGKAVEENFAAVKEAYEV
AAVIPAKKVDASAKPKGIISTTSAFLTGPYEVVGWREVNKAGAVFPGSSFPYATGGWRID
KPVIDHSKCIMCRKCWLYCPDDAIIEAWVEREGPRGRKFRMKMIDFDYQYCKGCGVCAEV
CPTGAIQMVREI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaatcgaaacagtctgggtaggccgcggaggccagggcattgtcacagctacttat
attatcgcaaatgcgtctattatagacggctttcacgcaatagccaatcccgagttcggg
gccgagcgcaggggagcgccggtcaaggccttcctaacaataagcaaagagcccatagaa
gaccaagagccggtcaaaaccccccacgtcgcggtggtattcgacgacaagttactcggc
gctatgcagttcgtcatagacgcggtgaagccggggggctacgtcatattgaacaccgga
aagagcccgcaagatgcagcggctcttgtgggaagagacgacgtaaacatagtggtgatc
gacgccatagccatcgccaggaagcacctcaagctagacgtccccaacgggcccctagcg
ggagcattctccaaggtgatggggttcccaagcctccagtctattagagaggccttcgag
acgcaactaggcaaggccgtggaggagaacttcgccgcggtcaaagaggcctacgaagtc
gccgcagtgataccagccaagaaagtagacgcctcggccaagcccaagggcataatctca
actacgtcggccttcctaactgggccctacgaagtcgtgggctggcgcgaggtgaacaaa
gccggtgcggtgttccccggatcaagcttcccctacgccacgggcggctggcgtatagat
aagccggttatagaccactccaagtgcatcatgtgcaggaagtgctggctctactgcccc
gacgacgcgatcatagaggcttgggtggagagggaggggccgaggggtaggaagttccgc
atgaagatgatagacttcgactaccagtactgtaagggttgtggcgtctgcgcagaagtt
tgtccaactggggcaatacaaatggtgagggagatatga

DBGET integrated database retrieval system