KEGG   Pyrobaculum arsenaticum: Pars_2316Help
Entry
Pars_2316         CDS       T00503                                 

Definition
(RefSeq) hypothetical protein
  KO
K19664  
CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase [EC:2.7.7.67]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pars_2316
Enzymes [BR:pas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.67  CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase
     Pars_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2070839..2071333
Genome map
AA seq 164 aa AA seqDB search
MDLFVFFALIWPPYVANGSAVLASRLKWRHPVDFGHNFVDGRRLFGDGKTYEGLAIGVVL
GTVVGYLPNLLHPTLTLLDALILSVAALLGDLLGAFIKRRLCMPRGHPAFPLDQLDFILM
AMLVRSLYADVPVEYIIAASVVTPIIHRATNIAAYILRLKKEPW
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggatctctttgtttttttcgcgcttatctggcctccctacgtcgccaatggctccgca
gttttggcgtcgaggctcaagtggcgccacccggtagactttgggcacaacttcgtagat
ggccggcgcctttttggagatggcaagacatacgagggtttggctataggcgttgtcttg
ggcacagtcgtagggtatctccccaatctcctacatccaacattaaccttgttagatgca
ctaattctctcagtcgctgccctcctcggcgatctgcttggggcttttataaagaggagg
ctgtgcatgccgagggggcaccccgcctttcccctagaccagctggacttcatcctcatg
gcaatgctggttcgtagcctctacgcagacgtccccgtagagtatataatagccgcatcg
gtagttacgccgataatacatagagcaaccaacatagccgcatacattctaaggctaaaa
aaagagccttggtaa

DBGET integrated database retrieval system