KEGG   Pyrobaculum arsenaticum: Pars_2316Help
Entry
Pars_2316         CDS       T00503                                 

Definition
hypothetical protein
Organism
pas  Pyrobaculum arsenaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2070839..2071333
Genome map
AA seq 164 aa AA seqDB search
MDLFVFFALIWPPYVANGSAVLASRLKWRHPVDFGHNFVDGRRLFGDGKTYEGLAIGVVL
GTVVGYLPNLLHPTLTLLDALILSVAALLGDLLGAFIKRRLCMPRGHPAFPLDQLDFILM
AMLVRSLYADVPVEYIIAASVVTPIIHRATNIAAYILRLKKEPW
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggatctctttgtttttttcgcgcttatctggcctccctacgtcgccaatggctccgca
gttttggcgtcgaggctcaagtggcgccacccggtagactttgggcacaacttcgtagat
ggccggcgcctttttggagatggcaagacatacgagggtttggctataggcgttgtcttg
ggcacagtcgtagggtatctccccaatctcctacatccaacattaaccttgttagatgca
ctaattctctcagtcgctgccctcctcggcgatctgcttggggcttttataaagaggagg
ctgtgcatgccgagggggcaccccgcctttcccctagaccagctggacttcatcctcatg
gcaatgctggttcgtagcctctacgcagacgtccccgtagagtatataatagccgcatcg
gtagttacgccgataatacatagagcaaccaacatagccgcatacattctaaggctaaaa
aaagagccttggtaa

DBGET integrated database retrieval system