KEGG   Pyrobaculum arsenaticum: Pars_2349Help
Entry
Pars_2349         CDS       T00503                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pas  Pyrobaculum arsenaticum
Brite
Enzymes [BR:pas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pars_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2100036..2100653
Genome map
AA seq 205 aa AA seqDB search
MAKKLVDDLEREGVLKSERVKKALLSVPREEFVMPEYRMMAYEDRPLPLFADATISAPHM
VAMMCELIEPRPGMSILEVGTGSGYHAAVCAEAIERRGKVYTVEIVKGLAIYAAQNLERL
GYWGVVEVFHSDGKRGLEKFAPYDAIIVTAAAASIPSALVNQLKDGGIMVIPVEEGFGQV
LYKVVRRGEKTEKKAVTYVLFVPLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaacttgtcgacgatctggagcgcgaaggtgttctaaaaagcgagcgggtg
aaaaaggcgcttctgtcagttccaagagaggagttcgtcatgcccgaatataggatgatg
gcatatgaggataggccacttccgctatttgcagacgccactatctcggcccctcacatg
gtggccatgatgtgcgagctaatagaaccaagaccaggtatgagtatcttggaggtcggg
actgggtctggctaccacgcagctgtatgcgctgaggccatagagaggaggggtaaggta
tatacagtggagattgtgaaggggcttgctatttatgccgcgcagaatctagagagactg
ggatattggggcgttgtggaggtttttcacagcgatggaaagagggggctggagaaattt
gcgccgtacgacgcaattatcgttactgcggcggccgcgtcaataccatctgcgcttgta
aaccagttgaaagacggcggtatcatggtgattcccgttgaggaaggatttgggcaagta
ctttacaaagtggtaaggaggggagagaagacggagaagaaggccgtgacgtatgtgctt
ttcgtaccgttgagatag

DBGET integrated database retrieval system