KEGG   Pseudoalteromonas atlantica: Patl_0137Help
Entry
Patl_0137         CDS       T00372                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pat00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(164393..165229)
Genome map
AA seq 278 aa AA seqDB search
MPTDQISALLDIAKTAAKEAGKVVMEIYDSGDFKSYQKDDDSPVTSADYKANEVILAILQ
RETPHIPIMSEESENGTLAERKDWQRYWLIDPIDGTQEFIARSGDFAVNIALVENNQPII
GVIYWPPGETLYFASKDNGAFKESESENKQIFVRKFDDPETDAVMIAISRRQARENVMRS
MSDHRTYQTYPTGSCSLKSCFIAEGKADVFLRLGITGEWDTGASQCIVSEAGGSILAHDF
SSLSYNERDSVTNPDFIVMGDQRVNWQTIVKYTTGDTE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgaccaaatatctgcattactcgacatcgctaaaaccgcagccaaagaagct
ggcaaagtggtaatggaaatctatgacagtggtgactttaaaagctatcagaaagacgat
gactcacccgttacctccgctgactacaaggccaatgaagttattttggccatcttgcag
cgcgagactccgcatatccctatcatgtcagaagaatcagagaacggtacactagccgag
cgcaaagattggcaacgttattggttaattgatcctatcgacggtacccaagagtttatt
gccagaagcggtgattttgccgtgaatatcgcgctagttgaaaacaaccaacctattatt
ggcgtgatttactggcctccaggggagacgctttactttgcgtcaaaagataatggggca
tttaaagagagcgagtcagagaacaaacagatatttgtgcgcaagtttgacgacccagaa
accgatgcagtgatgattgccataagccgccgccaagcgcgagaaaatgttatgcgcagt
atgagcgaccaccgcacttatcaaacctatccaacaggcagttgttcgctaaaatcgtgc
tttatcgcagaaggtaaagcagatgtgttcttgcgcttaggcattactggcgagtgggat
actggcgcttctcagtgtatcgtcagtgaagcaggcggcagtatactcgctcacgacttt
tcttccttgagttacaacgaacgtgattcagttaccaacccagattttatcgtcatgggt
gaccaacgagtaaattggcaaaccatagtgaaatacaccacaggagataccgaatga

DBGET integrated database retrieval system