KEGG   Pseudoalteromonas atlantica: Patl_0341Help
Entry
Patl_0341         CDS       T00372                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00860  Porphyrin and chlorophyll metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
Module
pat_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Patl_0341
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Patl_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 adh_short_C2 Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: ABG38872
UniProt: Q15Z16
Position
complement(399910..400632)
Genome map
AA seq 240 aa AA seqDB search
MTVLIFRPEQKCAPSAARFITAGLPAVGVGLISTQASQEALSSLPSALGSLSSGDGIIVT
STVVSQLLAQQRIELPNSATIFAVGSSTAQGLRAQGYDVTVPLVPTTEGLLALSPLKEIA
GHTVVILKGQGGREDLAQQLTQRGATVLLADIYQRIKIATPKATQEWQAEQIRCIIATSG
EIIDTAFEHFDAKWLQSLPWIVVSPRTEQIAVKQGIKTIFVSDDASDQALIRRAKEFLEH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgctgatattccgcccagagcaaaaatgcgccccaagcgcagcgcgctttatt
actgcgggtttacctgcggttggcgtcggcctgattagtacacaagccagtcaagaagct
ctgagctcattgccgagcgcacttggctctctatcctctggtgacggtattattgtaacc
agtacggtagtcagtcaactattggcgcagcagcgcattgaactaccaaattcagcgaca
atttttgccgttggtagcagtactgcccaaggtctacgggcacaaggttacgacgtgact
gtgcctctcgtgcctaccaccgaaggcttgttagcgctctcccccctaaaagaaatcgct
gggcatacagtcgtgattttaaaaggccaaggcggccgtgaagatttagcccaacaactt
acccagcgcggcgctactgttttgctagcagatatttatcaaaggataaaaattgccacg
cctaaagccacacaagagtggcaagcagagcagattagatgcatcattgctaccagtggt
gaaataatagatacggcgtttgagcatttcgatgctaagtggctacaatctttaccttgg
attgtggtaagcccacgaactgaacaaattgccgtaaaacaaggtataaagacaatattt
gtcagcgatgacgctagcgaccaggcacttattcgccgtgccaaggaatttttggagcat
taa

DBGET integrated database retrieval system