KEGG   Pseudoalteromonas atlantica: Patl_0395Help
Entry
Patl_0395         CDS       T00372                                 

Definition
pyridine nucleotide-disulfide oxidoreductase dimerisation region
Orthology
K00520  
mercuric reductase [EC:1.16.1.1]
Organism
pat  Pseudoalteromonas atlantica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(450118..452259)
Genome map
AA seq 713 aa AA seqDB search
MNSKRAILVIVIAALIASFFVFDLNQYLTLESLKNNQQDLAQYIEANWLVAFVGYLAIYA
AATALSVPGAAILTLGAGALFGFGWGLLLASFASSIGATLAFLASRFLLRDWVKSTFSKK
LESIDKGIEKDGAFYLLSLRLVPIFPFFIINLVMGVTGIKTWTYYWVSQLGMLIGTAVYV
NAGTQLVEINQLSDIISTDLILSFVLLGIFPILAKFILSALQQRRVYKGWKKPKKFDRNL
VVIGAGSAGLVTAYIAAAIKSKVTLVERHKMGGDCLNTGCVPSKSILHASKLAHIHHTSQ
NAGVTYDAPKIDFKAVMNKVHSVIKSIEPHDSVERYESLGVNVAIGNATIVSPWQVDIQT
ENGVESLTTRNIVIATGARAFVPDIPGLKDIDYLTADNLWEITEQPKRMIVLGGGPIGCE
LSQAFGRLGTHVTQIERGDQVLSKEDPDAAKHLQIQLEKDGIDLRLNTSAMAVETTSEGN
VLVVEFEGKEERIPFDKILVAVGRQANLTGFGLEKLGIETDRTVITNDFLQTKYPNILAA
GDVAGPYQFTHTASHQAWYAAVNALFRPFKIFKVDYSVIPWATFAEPEIATVGLNEMSAK
QQGIEVEVTRYDIGGLDRALADDHARGFVKVLTKPGKDKILGATIVGANAGELLAEFVLA
MKHGLGLNKILGTIHIYPTMAEANKNVAGNWKKDHAPQKVLDFLERFHTWRRK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaaacgtgcaatattagtcatcgtcattgctgcgctcatcgccagctttttt
gtctttgacctgaatcaatacctcacacttgagagccttaaaaacaatcagcaagatctt
gcgcaatatattgaagcgaactggttggtcgcatttgttggctacttggccatttatgct
gcagccaccgccttgagtgtacctggggcagctattcttacattaggcgcaggtgcctta
ttcggcttcggctggggcttattattagcttcattcgcttcaagcattggtgcaacgttg
gccttcttagcgtcgcgtttcttattgcgggattgggtaaaaagtaccttctcgaaaaag
ctagaatctatcgataaaggcatcgaaaaagacggtgcattctacttattgagcttacgt
ttagtgcctatcttcccgttttttatcatcaacctagtgatgggtgtgacgggtataaaa
acatggacttattactgggttagccaactaggcatgttgattggcactgccgtttatgtg
aatgcaggtactcaattagtcgaaatcaaccagttgtcagacattatctcaacggattta
atcctttcgtttgtcctgttaggcatattcccgattttggctaagtttattttaagtgcg
ctgcaacaacgccgtgtttacaaaggctggaaaaaacccaagaaattcgatcgtaaccta
gtggttatcggtgcaggttcggctggtttggtaacggcttatattgccgcggccattaaa
tctaaagtgaccttggttgagcgtcataaaatgggcggcgactgtttgaatacgggttgc
gtgccttctaaaagtatattgcacgccagtaagctagcgcatattcatcacacttcgcaa
aatgcgggtgtcacctatgatgccccaaaaattgattttaaagcggtcatgaacaaggtt
cacagcgtgattaaatccattgagccgcacgattctgttgagcgttatgaatcgctggga
gtgaatgtcgccataggtaatgctaccatcgtgtcgccttggcaggtggatattcaaacc
gagaacggtgttgaatcattaaccacgcgcaacattgttattgccacaggcgcccgtgca
tttgtaccagatattccaggtttgaaagacatcgactatttaaccgctgataacctttgg
gaaatcaccgagcagcctaaacgtatgatagtactaggcggcggcccaattggttgcgaa
ctgtctcaagcatttggtcgtttaggcacccatgtcacgcaaatcgaacgcggcgaccaa
gtattgagcaaagaagacccagatgcagcgaagcacttacaaattcaactcgaaaaagac
ggcatcgacttgcgcctgaacaccagcgccatggcagttgaaaccaccagcgaaggcaat
gtgttggtggttgagtttgaaggtaaagaagagcgtatcccgttcgataagatattggtg
gctgtgggtcgccaagcgaacctaacgggcttcggtttagaaaaacttggtatcgagact
gaccgtactgttatcaccaatgactttttacaaaccaagtacccaaatattttggcggca
ggcgatgtcgccgggccttatcagtttactcacaccgccagtcaccaagcttggtatgca
gcggtcaacgcgttatttagaccctttaaaatatttaaggtggactacagtgttattcct
tgggcaacctttgcggagccagaaattgccacggtagggttaaatgaaatgtctgctaag
caacaaggcatcgaagtagaggtcacacgttacgatattggcggtcttgaccgtgcatta
gctgacgatcatgcacggggttttgttaaagtgctcactaagcctggtaaagataagatt
ttgggtgccaccatagtcggtgccaatgcgggtgaattactggcagagttcgttttagcc
atgaaacacggccttggtttaaacaagattttggggactatccatatttacccgactatg
gctgaagcgaataaaaacgtcgcagggaactggaagaaagatcacgcaccgcaaaaagta
ctcgacttccttgaacgcttccacacgtggcgtcgcaagtaa

DBGET integrated database retrieval system