KEGG   Pseudoalteromonas atlantica: Patl_0425Help
Entry
Patl_0425         CDS       T00372                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pat01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pat00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pat00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pat00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pat00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pat00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
502924..504084
Genome map
AA seq 386 aa AA seqDB search
MHTNNDFEFKTVGDIRFGVNAALSLPALLISRFDAKSILVITDKGLLNAGVLDPVFAELD
VAGITFSVFDGVQADPPEAIILAAAEQAKKAEVVIGIGGGSSMDSAKLAAVLAMEQQNLA
DMYGVDLVTSQRKPLVLIPTTAGTGSEVTPISIVTTGESTKAGVVSPVLYPDVALLDPCL
TVGLPAHITAETGVDAMVHAIEAFTSKHKKNPLSDNLAIKALQLLSTHLPRCYVNGKDLD
HRGATLLGAMLAGQAFANSPVAAVHALAYPLGGIYHMAHGLTNALMLPHVMRFNLAHAEQ
EYAQLGVVVNPQLAGLSVREQALGFIEYMQQFCHDLGITKRLRDYGIEQAALTDLANAAM
LQTRLLTNNPRTVTFDDALALYQEAW
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaacaatgactttgagttcaaaaccgtaggcgatatccgttttggggtgaat
gcggctttgtctttacctgcactgttgatatcccgctttgatgcaaaatcgattctcgtc
attactgataaaggtttattaaacgcaggtgtgcttgatcctgttttcgctgaactggat
gtggctggcataacattctcagtgtttgatggcgtgcaggctgacccaccagaagccatt
attttggcggcagctgaacaagcgaaaaaagccgaagtggtgattggtattggcggcggc
agctctatggacagcgctaaactcgctgctgtgttggctatggagcaacaaaaccttgcc
gacatgtacggagtcgatttagtcacgtctcagcgtaaaccattggtattgatacctact
accgcaggaacaggctcagaagttacccctatctcaattgtcaccacgggtgaatcaacc
aaggctggtgtggtatcaccggttttataccccgatgtggcgttgcttgacccttgtcta
acggtggggttaccagcacatatcacggcagaaacgggcgtcgacgctatggtgcacgcc
attgaagctttcaccagcaaacataagaaaaacccgttatcagataatctcgcgataaaa
gcattgcaattgttgtcgacccatcttcctcgttgctatgtaaacggtaaagacttagat
cacagaggcgctacgctattgggcgccatgctcgcagggcaggcattcgctaactcccca
gtggcggccgtgcacgcgttggcctatccattaggcggtatttatcatatggctcacggt
ttaacgaatgcacttatgctgcctcacgtgatgcgtttcaacttggcacacgcagagcaa
gaatatgcccagttaggtgtagtcgttaaccctcaattagctgggcttagcgtgagggag
caagcactgggttttattgaatatatgcagcagttttgtcacgaccttggcatcaccaag
cgactaagagattacggtattgagcaagctgcgctaacggatttagccaacgcggccatg
ctgcaaacgcgattgttaaccaataatccgcgaacggttacgtttgatgatgctctcgcg
ttatatcaagaggcgtggtga

DBGET integrated database retrieval system