KEGG   Pseudoalteromonas atlantica: Patl_0425Help
Entry
Patl_0425         CDS       T00372                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Patl_0425
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_0425
  Lipid metabolism
   00071 Fatty acid degradation
    Patl_0425
  Amino acid metabolism
   00350 Tyrosine metabolism
    Patl_0425
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Patl_0425
   00626 Naphthalene degradation
    Patl_0425
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Patl_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
502924..504084
Genome map
AA seq 386 aa AA seqDB search
MHTNNDFEFKTVGDIRFGVNAALSLPALLISRFDAKSILVITDKGLLNAGVLDPVFAELD
VAGITFSVFDGVQADPPEAIILAAAEQAKKAEVVIGIGGGSSMDSAKLAAVLAMEQQNLA
DMYGVDLVTSQRKPLVLIPTTAGTGSEVTPISIVTTGESTKAGVVSPVLYPDVALLDPCL
TVGLPAHITAETGVDAMVHAIEAFTSKHKKNPLSDNLAIKALQLLSTHLPRCYVNGKDLD
HRGATLLGAMLAGQAFANSPVAAVHALAYPLGGIYHMAHGLTNALMLPHVMRFNLAHAEQ
EYAQLGVVVNPQLAGLSVREQALGFIEYMQQFCHDLGITKRLRDYGIEQAALTDLANAAM
LQTRLLTNNPRTVTFDDALALYQEAW
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaacaatgactttgagttcaaaaccgtaggcgatatccgttttggggtgaat
gcggctttgtctttacctgcactgttgatatcccgctttgatgcaaaatcgattctcgtc
attactgataaaggtttattaaacgcaggtgtgcttgatcctgttttcgctgaactggat
gtggctggcataacattctcagtgtttgatggcgtgcaggctgacccaccagaagccatt
attttggcggcagctgaacaagcgaaaaaagccgaagtggtgattggtattggcggcggc
agctctatggacagcgctaaactcgctgctgtgttggctatggagcaacaaaaccttgcc
gacatgtacggagtcgatttagtcacgtctcagcgtaaaccattggtattgatacctact
accgcaggaacaggctcagaagttacccctatctcaattgtcaccacgggtgaatcaacc
aaggctggtgtggtatcaccggttttataccccgatgtggcgttgcttgacccttgtcta
acggtggggttaccagcacatatcacggcagaaacgggcgtcgacgctatggtgcacgcc
attgaagctttcaccagcaaacataagaaaaacccgttatcagataatctcgcgataaaa
gcattgcaattgttgtcgacccatcttcctcgttgctatgtaaacggtaaagacttagat
cacagaggcgctacgctattgggcgccatgctcgcagggcaggcattcgctaactcccca
gtggcggccgtgcacgcgttggcctatccattaggcggtatttatcatatggctcacggt
ttaacgaatgcacttatgctgcctcacgtgatgcgtttcaacttggcacacgcagagcaa
gaatatgcccagttaggtgtagtcgttaaccctcaattagctgggcttagcgtgagggag
caagcactgggttttattgaatatatgcagcagttttgtcacgaccttggcatcaccaag
cgactaagagattacggtattgagcaagctgcgctaacggatttagccaacgcggccatg
ctgcaaacgcgattgttaaccaataatccgcgaacggttacgtttgatgatgctctcgcg
ttatatcaagaggcgtggtga

DBGET integrated database retrieval system