KEGG   Pseudoalteromonas atlantica: Patl_0465Help
Entry
Patl_0465         CDS       T00372                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pat  Pseudoalteromonas atlantica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(540401..541423)
Genome map
AA seq 340 aa AA seqDB search
MKNHDLENSFKHLKNTIPLLLKHKIPAVPLNYALWYTYASNESESLNETLDHALQRNLPI
SDSKTRDLYRKHVADEQDVDVWELRHSLESMVIELSQSVQDTRSETRNFKSTMDTCMDDL
AKVEREGLSMEEVMDLVRTLVSQTKQIRGSTLSFSTALNDAEREITRLRNQLEQSQQAAL
YDVLTGLCNRRYFDEELAAHAMRPNMCLILADLDHFKKINDTHGHVMGDLVLKASAKKLQ
AACREGAQAFRFGGEEFAIIVPNSKLSVARQIAETMRRSIEKIGVRDKRTSQVLGGISAS
FGIAEMKTGMNPLALIEAADKQLYEAKNLGRNRVMPMSNG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatcacgatttagagaattcatttaaacatctaaaaaacaccatccctttattg
cttaagcataagatccctgccgtgccgctcaactatgccctgtggtacacctatgcaagt
aatgaatctgaatcccttaatgaaactcttgatcatgctttgcagcgcaatttacccata
tcagattcaaagacccgagacttatatcgcaaacatgtagcggatgaacaagatgtagat
gtgtgggagcttcgtcactctcttgaaagcatggtgattgaactgtctcaatctgtgcaa
gatacccgcagtgaaacacgtaactttaaaagtaccatggatacctgcatggacgactta
gcgaaagtagagcgagaaggcttgagtatggaagaggtcatggacttagtccggaccttg
gtcagtcaaaccaaacaaattcgtggaagtactttatcttttagcaccgcacttaatgat
gcagaaagagaaattacgcgattaagaaatcaacttgaacaaagccaacaagcagcctta
tatgacgttttgactggcctgtgtaatcgtagatactttgacgaagagttagcagcacat
gctatgcgaccaaacatgtgcctaatattggctgacttagatcattttaaaaagatcaat
gacacccatgggcatgtcatgggggatttggttttaaaagccagcgctaaaaaactccaa
gctgcatgcagagaaggggcgcaagcatttcgctttggtggtgaagagttcgccattatt
gttcccaatagtaagctcagcgttgccagacaaatagccgaaaccatgcgcagatctatc
gaaaaaattggggttagagataaacgtacatcccaagtactcggaggaataagtgcttca
tttggtattgccgaaatgaaaaccgggatgaatcccttggcgcttattgaggctgcggat
aaacagctatatgaagcaaagaacttaggtcgaaatcgtgtaatgcccatgtctaacggt
taa

DBGET integrated database retrieval system