KEGG   Pseudoalteromonas atlantica: Patl_0521Help
Entry
Patl_0521         CDS       T00372                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00010  Glycolysis / Gluconeogenesis
pat00620  Pyruvate metabolism
pat00640  Propanoate metabolism
pat00680  Methane metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_0521
   00620 Pyruvate metabolism
    Patl_0521
   00640 Propanoate metabolism
    Patl_0521
  Energy metabolism
   00680 Methane metabolism
    Patl_0521
Enzymes [BR:pat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Patl_0521
Lipid biosynthesis proteins [BR:pat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Patl_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABG39050
UniProt: Q15YI8
Position
604827..606767
Genome map
AA seq 646 aa AA seqDB search
MSQQIYPVPAHAKEHSHLTPADYARMYAESVEQPEVFWAEQAKSLDWVKTPTKIKNTSFD
AHHVSIKWFEDGELNVAYNCIDRHLAKRGHVTAFIWEGDDPHSHDIITYHRLHDEVAKIA
NGLRKLGVGKGDRVAIYMPMIPQAVYAMLACARIGAVHTVIFGGFSPNAIADRVNNCQAK
VLITADEGLRAGKHIPLKDNVDTALAEHDCPSMEQVIVFKHTGSHVSWGKDDVWWHDLTD
GCSTDCPPEVMNAEDPLFILYTSGSTGQPKGVVHTTGGYLLWASITHKYVFDYKPGDIYW
CAADVGWVTGHSYIVYGPLANGATSVMFEGVPTYPDVRRIGQIVDKHKVNILYTAPTAIR
ALMAHGDFPTEGISGESLRLLGSVGEPINPEAWHWYYTTVGQSRCPIVDTWWQTETGAAM
LTPLPSVTAMKPGAASHPFFGVQPALVDGQGNELSGATEGNLIITDSWPGQARTVYGDHE
RFVQTYFTTYPGTYCTGDGARRDEDDYFWITGRVDDVLNVSGHRLGTAEIESALVSHNAV
AEAAVVGYPHDLKGQGIYVYLMPNEGVEITDELTKEVSNWVRKELSPIATPDLIQWSSGL
PKTRSGKIMRRILRKIAANEYEQLGDTSTLADPSVVDTLIEQRLNR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacaaatttatcccgttccagcacacgctaaagagcatagccaccttacacca
gccgattacgcgcgcatgtacgcagaatcagtagagcaacctgaagtattctgggctgag
caagctaaatcacttgattgggtcaaaaccccaaccaaaatcaaaaacacgtcttttgat
gctcatcatgtaagtatcaagtggtttgaagacggcgaattgaatgtggcatacaactgt
attgatcgtcacttagcgaaaagaggtcacgtaacagcctttatctgggaaggtgacgac
cctcatagccacgacattatcacttaccatcgtttacatgacgaagtcgcgaaaatcgcc
aacggcttgcgcaagctaggtgtaggcaagggcgacagagttgcgatttatatgcctatg
atcccgcaggctgtgtatgccatgcttgcatgcgcgcggataggcgctgtacacaccgtc
attttcggcggtttttcgcctaatgcaattgccgacagagtgaataattgtcaagcgaag
gtgttgattaccgcggatgaagggctaagagctggtaagcatattccattaaaagacaat
gtggatacggcattggctgaacatgactgccctagcatggagcaagttatcgtattcaaa
cataccggcagtcacgtgagctggggtaaagatgatgtttggtggcatgacttaacggat
ggttgttctaccgattgtccgccagaggtaatgaacgcagaagatccgctttttatcttg
tatacatccggctctaccggccagcctaaaggagtagtgcacaccaccgggggttacttg
ctatgggcatccatcacccataaatacgtttttgattataaaccaggagatatttactgg
tgtgcagccgatgttggctgggtgacaggtcacagttatatcgtatatggccctcttgcc
aacggcgcgaccagtgttatgtttgaaggggtacctacttaccctgatgtacgccgaatt
ggccaaatagttgataagcacaaggtgaatatcctttacacggcgcctactgctattcgt
gcattaatggcccacggtgatttccccactgaggggattagtggcgaatcattacgctta
cttggttcagtgggtgagcccattaacccagaggcatggcattggtattatacgactgtt
ggccagtcacgatgcccgattgtggacacatggtggcaaactgaaacgggcgctgccatg
ttaacacctctccccagtgtcacagcgatgaagccaggcgctgctagccatccatttttc
ggtgtgcagcccgcattggtagacggccaaggcaatgaattgtctggcgcaactgaaggc
aatttaattattaccgatagttggccaggtcaagcgcgcaccgtttacggcgatcacgaa
cgttttgtgcaaacgtattttaccacttacccaggtacttattgcaccggtgatggtgct
cgtcgtgacgaggacgattacttctggatcacagggcgagtagatgatgtactcaatgtg
tcgggccatcgcttaggtaccgctgaaattgaaagtgcactggtttcccataatgcggta
gctgaagccgcggtggtaggctacccccatgatttgaaaggccaaggtatttatgtatat
ctgatgcccaatgaaggtgttgagataacggatgagcttacaaaagaggtttctaattgg
gtacgtaaagaacttagccccattgcgacaccagacttgatacaatggtcctcagggtta
ccgaaaacacgctctggtaaaattatgcgccggattttgcgcaaaattgctgccaatgaa
tatgaacaactcggtgatacgtctacgttagctgacccaagtgtggttgataccctaata
gagcaacgtttgaaccgataa

DBGET integrated database retrieval system