KEGG   Pseudoalteromonas atlantica: Patl_0548Help
Entry
Patl_0548         CDS       T00372                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pat00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
639081..639635
Genome map
AA seq 184 aa AA seqDB search
MSDDLTQHYSQILSILGEDTQRGGLVDTPKRAAKAMQFLTDGYEKNLNDVVNGAIFEADT
DEMVVIQNIEYYSLCEHHILPFIGQCHIAYLPQGKVLGLSKFARIVDMYARRLQIQEGLT
KQIADAIQEVTGAAGVGVIMEGKHMCMMMRGVQKQNSSMVTSVMLGAMRKSDATRNEFLR
LIGK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgatttaacccagcattactcgcaaattctttcgatcttaggtgaagatact
cagcgaggtggtttagtagatacgcctaaacgtgccgccaaagcgatgcagtttttgacc
gatggttacgagaaaaaccttaatgacgtagtgaatggcgctatttttgaagccgacact
gacgaaatggtcgttattcaaaatattgaatactattcactgtgcgagcaccatattttg
ccgtttattggacagtgccatattgcttatctacctcaggggaaagtgctaggactatct
aagtttgctcgcatcgttgacatgtacgcgcgtcgcctgcagatccaagagggtttaacc
aagcaaatagcggatgccattcaagaagttactggggcggctggtgtaggcgtgatcatg
gaaggcaaacatatgtgcatgatgatgcgtggtgttcaaaagcaaaactcgtccatggtg
acatcagtaatgctaggtgcgatgcgtaagtcagatgcaacacgtaatgaatttcttcgt
ttaattggtaagtaa

DBGET integrated database retrieval system