KEGG   Pseudoalteromonas atlantica: Patl_0989Help
Entry
Patl_0989         CDS       T00372                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Patl_0989
Enzymes [BR:pat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Patl_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1181180..1182088
Genome map
AA seq 302 aa AA seqDB search
MRSLTKGDFMGHSGVNISYAYLCHPHAIGAVAISTGRIESWVKYQEVMFDLYQNGYSVFI
HDHRGQGLSGRMTRNPHMGFVDDFTDYVADFKLFYQKIIEPNTQHRPQLLCHSMGCAIGA
LYVLAHPQDFAQLIVCAPMFGIRPALPNWLASILIGANLLISRGLGHDASYFLGQKNYQE
TEFALNELTHSEIRYRLFRDEYNLQPEVQLGGVTGHWLRAALKAMDAIEAQASQISIPVW
AIQAEADTVVDNKRQSRVLAKLPHCEVQQIFGARHEMLLEEDQYRRPCLAAILAFLRLAN
DR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctctgaccaaaggcgattttatggggcattcaggtgtaaacattagttatgcc
tatttgtgtcatccgcacgcgattggtgccgtggctatctctacagggcgaattgagtct
tgggttaaatatcaagaagtcatgttcgacttatatcaaaatggatattcggtgttcatt
catgatcaccgtggtcaaggcttatcagggcgcatgacccgcaacccccatatgggtttt
gtggacgattttaccgattacgttgctgactttaagctgttttaccagaaaatcattgag
cctaacacgcagcataggcctcagttattgtgccactctatggggtgtgcaattggggct
ttgtatgttttagcgcatccgcaagatttcgctcaactaattgtgtgtgcccctatgttt
ggcattcgccccgcgttacctaattggctggcgagtattttaataggcgcaaacttgctt
attagtcgcggtttaggtcatgacgctagttattttcttggccaaaaaaattatcaggaa
accgagttcgcgcttaatgagctcacccacagcgaaatacgttatcgcctcttcagagac
gagtataatttgcaaccagaagtgcaattaggaggtgtgaccgggcattggttgcgagca
gccctaaaagcgatggatgccattgaagctcaagcgagtcaaatatcgatccccgtttgg
gccattcaagcagaggcggatacagtggtggacaacaaaaggcaaagtcgtgtattagcc
aaattgccccattgcgaagtacaacaaatttttggtgctcggcacgaaatgctgcttgaa
gaagaccaatatcgtcgcccctgtttagcggctattctagcgtttctgcgattggcaaat
gacagataa

DBGET integrated database retrieval system