KEGG   Pseudoalteromonas atlantica: Patl_1045Help
Entry
Patl_1045         CDS       T00372                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pat00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1248648..1249166
Genome map
AA seq 172 aa AA seqDB search
MSAQAPQHTIFISVGSNINREQHISAGLDAMYAAFGELTLSSVYESKSVGFDGNNFYNLV
VQADTHLPIIEVVERLKKIETENLRTRESKKFAPRTLDLDLLTYDDVIIQTPMELPRPEI
LYNAFVLQPLAEIAPEVEHPLANKSYLSLWQQYDKSQQQLWPIKFTWSANRQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacaagcacctcagcatactattttcatcagtgttggcagtaacattaatcga
gagcagcatatcagtgctggtcttgatgctatgtatgcagcgtttggtgaactcacttta
tcatcggtttacgaaagcaaatccgttggattcgatggaaataacttttacaacttagtg
gtacaggccgacactcacttacccatcattgaagtggtagagcgcttaaagaaaatagaa
accgaaaacctgcgcacccgcgaaagcaaaaaatttgctccgcgaacgttagatcttgat
ttactgacatacgatgatgtcattattcaaacaccgatggaacttccacgccctgagatc
ctctacaatgcgtttgtgttgcagcctttagcggaaattgcacctgaagtagagcatccg
ctagcgaataaaagctacctttccttatggcagcaatacgataaatcccaacaacagtta
tggcctatcaaatttacatggagcgctaatcgccaatga

DBGET integrated database retrieval system