KEGG   Pseudoalteromonas atlantica: Patl_1213Help
Entry
Patl_1213         CDS       T00372                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00620  Pyruvate metabolism
pat00630  Glyoxylate and dicarboxylate metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01200  Carbon metabolism
Module
pat_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Patl_1213
   00630 Glyoxylate and dicarboxylate metabolism
    Patl_1213
Enzymes [BR:pat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Patl_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABG39739
UniProt: Q15WJ9
Position
complement(1462116..1464290)
Genome map
AA seq 724 aa AA seqDB search
MQQYIQREQLQVAPQLAAFIEEQALPSSEVAPTEFWAGFSNILAQLTPVNDALLAKRDLL
QQKIDAYCQSHPTLEPASYKTFLQEIGYLETPPADFSITTDNVDDEVATMAGPQLVVPIN
NARFALNAANARWGSLYDAAYGTDVIPEDNGATRTKAYNPARGQQVIQYARKWLDVIAPL
TNGSHTTSQGYDITSGQLVVTLADASTATLSHPTQLLGFVGDKNNPSAILLQHNGLHVEL
QFDRTHQIGQSDPCGMKDILVESALTTIMDCEDSVAAVDAEDKTLVYQNWLGLIKGTLEV
SLSKPGGSSVRRLSADRNYTTLTGKSFSLNGRSMMFVRNVGHLMTNDAILFQGKPIYEGI
MDAVITSLIAKHDLLGNGQYRNSKAGSIYIVKPKMHGSEEVAFADTLFSQVEDALALPKN
TLKMGIMDEERRTSVNLKACINAAKARAVFINTGFLDRTGDEIHTSMHLGPFALKADIKQ
QPWLTAYELANVKIGVDAGMSGKAQIGKGMWPIPDNMADMMQSKTNHPQSGANTAWVPSP
TAATLHALHYHQIDVFSLRNPIASNDFDGLDDILTVPLLADCSSLSQQDIQHELDNNVQG
ILGYVVRWVHQGIGCSKVPDINNVGLMEDRATLRISSQHIANWLLHGLINEAQINDSMLR
MAQLVDAQNSSDKEYIPMMPDPIKSIAFQAAQELILQGTQQPNGYTEPVLHAKRREMKDK
LATV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatatattcaacgtgaacaattacaggtagcgcctcagcttgctgcctttatc
gaagagcaggctctacctagcagtgaagtcgcccccacagaattttgggctggttttagt
aatattctagcccagctcacgccagttaatgatgccttactggctaagcgcgacttgcta
caacaaaaaatcgatgcgtattgccagtctcatccgaccttagagcctgcgagctacaaa
actttccttcaagaaattggctatctagaaacgccaccagcagatttttctattaccacc
gataacgttgacgacgaggtggctaccatggccggccctcaacttgtagtgcctatcaat
aacgcgcgcttcgctcttaacgctgctaatgcccgttgggggagcttatacgatgcagcc
tacggtacagatgttatccctgaagataacggcgctacgcggacaaaagcatacaatccc
gcaagagggcaacaggttatacagtatgcaagaaagtggctcgatgtaatcgcaccattg
accaatggctcccataccaccagtcaaggttatgatattacttcaggtcaactagtggta
acgctagccgatgcgagcacagcgaccttgtctcaccctacccagttacttggatttgtt
ggcgataaaaacaaccctagcgccattttgttacaacataacggcctgcacgtagagctg
caatttgaccgcactcatcaaatagggcaaagcgacccctgtggcatgaaagacatatta
gttgaatcagcactgacaaccattatggattgtgaggactcagttgccgcagtggatgct
gaagataaaaccttggtgtatcagaactggctaggactgatcaaagggacgcttgaagtg
agcctaagtaaaccaggcggctcctccgtcagacgtttaagtgccgatagaaattacacg
acgcttacaggcaaatcattttcgctaaatggtcgtagtatgatgtttgtgcgtaatgtg
ggccatttaatgacgaacgacgcaattttgtttcagggtaagccgatctacgaagggata
atggacgcggttatcaccagcctaatcgccaaacatgacttgctaggcaatggccaatat
cgcaacagtaaagcgggcagtatatatatcgttaaacccaaaatgcatggctcagaggaa
gtggcattcgctgacactttgtttagtcaagtagaagatgctttagcactgcctaaaaac
acattaaaaatgggcattatggacgaagaacgtcgcacaagtgtgaatttgaaagcgtgt
atcaatgcagcaaaagcgcgcgcagtattcattaatacgggctttttagatagaactggg
gatgaaatccatacctcaatgcatctagggccatttgcgttaaaagctgacatcaagcaa
cagccttggttgactgcctacgagttagccaacgtgaaaattggtgtagacgcaggtatg
tcaggtaaagcgcaaattgggaaaggtatgtggccaattccagataacatggctgacatg
atgcaaagtaaaaccaatcaccctcaatcgggcgccaacactgcttgggttccctcccca
accgctgcgaccttgcacgccttacattatcaccagattgatgtgtttagtttgcgaaat
ccgattgcaagcaatgattttgatgggttagatgatatcttgaccgtgcccctcttggct
gactgttccagtttgagccagcaagacattcagcatgagctagacaataacgttcaaggg
attttgggttatgtggttcgctgggttcatcaagggattggttgctctaaagtaccggac
atcaacaacgtgggcctaatggaagacagagcaacgttacgcatatccagccagcatatc
gctaactggttgttacatggcttaattaacgaggcacaaataaatgactcaatgttgcgc
atggcacaattagtcgatgcacaaaatagttctgataaggaatacatccctatgatgcct
gacccaatcaaatcaattgcgtttcaagccgctcaagagttaatactgcaaggaacgcag
caaccaaatggttacaccgaacctgttttgcacgctaagcgcagggaaatgaaagataaa
ctggccactgtgtag

DBGET integrated database retrieval system