KEGG   Pseudoalteromonas atlantica: Patl_1213Help
Entry
Patl_1213         CDS       T00372                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_1213
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Patl_1213
   00630 Glyoxylate and dicarboxylate metabolism
    Patl_1213
Enzymes [BR:pat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Patl_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1462116..1464290)
Genome map
AA seq 724 aa AA seqDB search
MQQYIQREQLQVAPQLAAFIEEQALPSSEVAPTEFWAGFSNILAQLTPVNDALLAKRDLL
QQKIDAYCQSHPTLEPASYKTFLQEIGYLETPPADFSITTDNVDDEVATMAGPQLVVPIN
NARFALNAANARWGSLYDAAYGTDVIPEDNGATRTKAYNPARGQQVIQYARKWLDVIAPL
TNGSHTTSQGYDITSGQLVVTLADASTATLSHPTQLLGFVGDKNNPSAILLQHNGLHVEL
QFDRTHQIGQSDPCGMKDILVESALTTIMDCEDSVAAVDAEDKTLVYQNWLGLIKGTLEV
SLSKPGGSSVRRLSADRNYTTLTGKSFSLNGRSMMFVRNVGHLMTNDAILFQGKPIYEGI
MDAVITSLIAKHDLLGNGQYRNSKAGSIYIVKPKMHGSEEVAFADTLFSQVEDALALPKN
TLKMGIMDEERRTSVNLKACINAAKARAVFINTGFLDRTGDEIHTSMHLGPFALKADIKQ
QPWLTAYELANVKIGVDAGMSGKAQIGKGMWPIPDNMADMMQSKTNHPQSGANTAWVPSP
TAATLHALHYHQIDVFSLRNPIASNDFDGLDDILTVPLLADCSSLSQQDIQHELDNNVQG
ILGYVVRWVHQGIGCSKVPDINNVGLMEDRATLRISSQHIANWLLHGLINEAQINDSMLR
MAQLVDAQNSSDKEYIPMMPDPIKSIAFQAAQELILQGTQQPNGYTEPVLHAKRREMKDK
LATV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatatattcaacgtgaacaattacaggtagcgcctcagcttgctgcctttatc
gaagagcaggctctacctagcagtgaagtcgcccccacagaattttgggctggttttagt
aatattctagcccagctcacgccagttaatgatgccttactggctaagcgcgacttgcta
caacaaaaaatcgatgcgtattgccagtctcatccgaccttagagcctgcgagctacaaa
actttccttcaagaaattggctatctagaaacgccaccagcagatttttctattaccacc
gataacgttgacgacgaggtggctaccatggccggccctcaacttgtagtgcctatcaat
aacgcgcgcttcgctcttaacgctgctaatgcccgttgggggagcttatacgatgcagcc
tacggtacagatgttatccctgaagataacggcgctacgcggacaaaagcatacaatccc
gcaagagggcaacaggttatacagtatgcaagaaagtggctcgatgtaatcgcaccattg
accaatggctcccataccaccagtcaaggttatgatattacttcaggtcaactagtggta
acgctagccgatgcgagcacagcgaccttgtctcaccctacccagttacttggatttgtt
ggcgataaaaacaaccctagcgccattttgttacaacataacggcctgcacgtagagctg
caatttgaccgcactcatcaaatagggcaaagcgacccctgtggcatgaaagacatatta
gttgaatcagcactgacaaccattatggattgtgaggactcagttgccgcagtggatgct
gaagataaaaccttggtgtatcagaactggctaggactgatcaaagggacgcttgaagtg
agcctaagtaaaccaggcggctcctccgtcagacgtttaagtgccgatagaaattacacg
acgcttacaggcaaatcattttcgctaaatggtcgtagtatgatgtttgtgcgtaatgtg
ggccatttaatgacgaacgacgcaattttgtttcagggtaagccgatctacgaagggata
atggacgcggttatcaccagcctaatcgccaaacatgacttgctaggcaatggccaatat
cgcaacagtaaagcgggcagtatatatatcgttaaacccaaaatgcatggctcagaggaa
gtggcattcgctgacactttgtttagtcaagtagaagatgctttagcactgcctaaaaac
acattaaaaatgggcattatggacgaagaacgtcgcacaagtgtgaatttgaaagcgtgt
atcaatgcagcaaaagcgcgcgcagtattcattaatacgggctttttagatagaactggg
gatgaaatccatacctcaatgcatctagggccatttgcgttaaaagctgacatcaagcaa
cagccttggttgactgcctacgagttagccaacgtgaaaattggtgtagacgcaggtatg
tcaggtaaagcgcaaattgggaaaggtatgtggccaattccagataacatggctgacatg
atgcaaagtaaaaccaatcaccctcaatcgggcgccaacactgcttgggttccctcccca
accgctgcgaccttgcacgccttacattatcaccagattgatgtgtttagtttgcgaaat
ccgattgcaagcaatgattttgatgggttagatgatatcttgaccgtgcccctcttggct
gactgttccagtttgagccagcaagacattcagcatgagctagacaataacgttcaaggg
attttgggttatgtggttcgctgggttcatcaagggattggttgctctaaagtaccggac
atcaacaacgtgggcctaatggaagacagagcaacgttacgcatatccagccagcatatc
gctaactggttgttacatggcttaattaacgaggcacaaataaatgactcaatgttgcgc
atggcacaattagtcgatgcacaaaatagttctgataaggaatacatccctatgatgcct
gacccaatcaaatcaattgcgtttcaagccgctcaagagttaatactgcaaggaacgcag
caaccaaatggttacaccgaacctgttttgcacgctaagcgcagggaaatgaaagataaa
ctggccactgtgtag

DBGET integrated database retrieval system