KEGG   Pseudoalteromonas atlantica: Patl_1232Help
Entry
Patl_1232         CDS       T00372                                 

Definition
(GenBank) Inositol-1(or 4)-monophosphatase
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Patl_1232
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Patl_1232
Enzymes [BR:pat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Patl_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1482323..1483102)
Genome map
AA seq 259 aa AA seqDB search
MHPMLNIAVRAARSAGNVIARGFENQSELMIEAKGSNDFVTRVDKEAEQAIIRKIQQSYP
DHCFVGEEGGVVEGSNTDYKWIIDPLDGTTNFIKGIPHFAVSIALMHKGRLDQAVVFDPI
RGELFTASKGAGAQLNGFRIRASKAKELNQTILATALPYKNKDALPTYLESFRNIFFQAG
DVRRSGSAALDLAYVAAGRYDGYWESGLKPWDIAAGELLVREAGGLVTDFKGNNDPMHNG
DIVAGSAKVVQTLVKNLKA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctatgctgaatatagcagtgcgcgcggcgcgttctgcgggcaacgtcattgcc
cgtggttttgaaaatcaatctgaattaatgattgaagccaaaggcagtaacgacttcgtt
actcgcgtcgataaagaagccgagcaagcaattattcgcaaaattcaacaatcttaccct
gaccattgtttcgtgggtgaagaaggcggcgtagtagaaggtagcaacactgattacaaa
tggatcattgacccgctagatggcaccactaattttatcaagggtattccccacttcgca
gtatccatcgctttaatgcataaaggtcgtttagaccaggcggttgtgttcgatcctatt
cgtggcgaactatttaccgcaagcaaaggcgctggcgctcaacttaacggtttccgtatt
cgtgctagtaaagcaaaagagttgaaccaaacgatccttgccaccgcacttccatacaaa
aacaaagatgcattaccgacatatcttgaaagcttccgtaacatctttttccaagcgggt
gatgtgcgccgtagtggttcagctgctctggatttagcctacgttgccgctggtcgttac
gacggttactgggaaagtggcttgaagccatgggatattgcagcgggtgaacttctcgtt
cgtgaagctggcggcctggtaacagatttcaaaggtaataacgaccctatgcataacggt
gacatcgttgctggaagcgctaaagtcgtgcaaaccttagtcaagaatttgaaagcttaa

DBGET integrated database retrieval system