KEGG   Pseudoalteromonas atlantica: Patl_1255Help
Entry
Patl_1255         CDS       T00372                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00900  Terpenoid backbone biosynthesis
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Patl_1255
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Patl_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Epimerase Sacchrp_dh_NADP NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABG39781
UniProt: Q15WF7
Position
1503495..1504688
Genome map
AA seq 397 aa AA seqDB search
MQNICILGATGSIGQSTIDVVLRHPGLYQVYALTAHSQIDKLLEQAKLCQPKYLVLSDST
RYQNAKQALLASGIKTELLSGAQALADVASADEVDVVMAAIVGGAGLLPTIAAVKAGKKV
LLANKESLVMSGELFINAAKEHGATILPIDSEHNAIFQCLPHDFQYGDLAASGISSILLT
GSGGPFRETPLNRLSEMTPAQACAHPNWDMGQKISVDSATMMNKGLEFIEARWLFGLQTS
DIKVVLHPQSIIHSMVQYCDGSVLAQMGNPDMRTPIAHGLAFPKRIDSGVKPLDFQNVSN
FSFDEPEPQRYPNLYLAIEASDAGQYATTALNAANEVAVAAFLSGQIGFSQIAQVNQQCV
AKMQGCQLDDINAIVEWDKECRRQAQQIISSYSREAR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatttgtatattaggcgcaacaggctctattggacaaagcactattgatgtg
gtgttgcgccaccctggtttgtatcaggtttatgcgttaacagctcatagccaaatagat
aagctccttgagcaagccaaactgtgccaacctaagtatcttgtgttatccgacagcact
cgttatcaaaatgccaaacaagcgttactcgccagtggaataaaaacagagcttctgtca
ggcgcgcaagcgttagctgatgttgccagcgctgatgaggttgatgtagtgatggccgct
attgtcggtggtgcgggtttattaccaactatcgcggcggttaaagcgggcaagaaggta
ctattggccaacaaagaatcgttggtgatgtcaggcgagttattcattaatgcagctaaa
gagcatggcgcgacgatattgcccattgacagtgaacacaacgctatatttcagtgcttg
cctcatgactttcaatacggtgatttggcggcctccgggatcagcagtatcttattaacc
ggctcgggagggccgtttcgggaaacgccattaaatcgtttatctgagatgacacctgct
caagcatgtgctcaccctaattgggatatggggcaaaagatatcggtcgattccgccact
atgatgaataaaggcttggagtttattgaagcgcgttggttatttggcttgcaaacgagt
gatatcaaagtggtattacatcctcagagtattattcattccatggtgcagtattgcgac
ggttcagtgttagcccaaatgggcaacccagatatgcgcacgccgattgcccatggctta
gcgtttccaaaacgcattgattctggggttaaacctctggacttccaaaacgtgagcaat
tttagtttcgacgaacctgagccacaacgctatcccaatttatatttggcaatagaagca
tctgatgcaggccaatatgctacaaccgcattaaatgcagcgaatgaagtggcagtggca
gctttcttatctggccaaattggatttagccaaatagcccaagtcaatcaacaatgcgta
gcaaaaatgcaggggtgtcagctcgatgacatcaatgccattgttgagtgggataaggaa
tgtcgtcgtcaggcacaacaaattatttcatcttactcaagagaggcgcgctaa

DBGET integrated database retrieval system