KEGG   Pseudoalteromonas atlantica: Patl_1370Help
Entry
Patl_1370         CDS       T00372                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00071  Fatty acid degradation
pat00280  Valine, leucine and isoleucine degradation
pat00281  Geraniol degradation
pat00310  Lysine degradation
pat00360  Phenylalanine metabolism
pat00362  Benzoate degradation
pat00380  Tryptophan metabolism
pat00410  beta-Alanine metabolism
pat00627  Aminobenzoate degradation
pat00640  Propanoate metabolism
pat00650  Butanoate metabolism
pat00903  Limonene and pinene degradation
pat00930  Caprolactam degradation
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01212  Fatty acid metabolism
Module
pat_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Patl_1370
   00650 Butanoate metabolism
    Patl_1370
  Lipid metabolism
   00071 Fatty acid degradation
    Patl_1370
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Patl_1370
   00310 Lysine degradation
    Patl_1370
   00360 Phenylalanine metabolism
    Patl_1370
   00380 Tryptophan metabolism
    Patl_1370
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Patl_1370
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Patl_1370
   00281 Geraniol degradation
    Patl_1370
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Patl_1370
   00627 Aminobenzoate degradation
    Patl_1370
   00930 Caprolactam degradation
    Patl_1370
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Patl_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG39896
UniProt: Q15W42
Position
1651550..1652425
Genome map
AA seq 291 aa AA seqDB search
MENNVSDLDFSKLETLSVSIDQHIAHIQLSRPEALNSMIPIFWHELPATVRKIDEQSAAR
VIVISSQGKHFSAGMDLSVFTQMGKDFVGEPARRGERMRRMVLELQDSFNALESVRMPVL
VAMQGGVIGGAVDMVCAADSRYCTEDTYFTIKETEIGMTADVGTLQRLPHLIPQGLVREL
AYTGRNMGAKEAKESGLVNQVFADQESLLAGVMKIAAKIASNSPLAVAGCKEMINYTRDH
TVADALNYMATWQTGMFQMPDIQEAMSAAKEQRKPVYEELHKNISGMQRNK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagaataacgtgtctgatttagatttttcaaagctggaaaccttgagcgtcagtatt
gaccaacatatcgctcatattcagttgtctcgccccgaagcattgaacagtatgatcccc
atcttttggcatgaactgccggccactgtgcgcaaaattgatgaacagtcagctgcgcgt
gtcattgttatttcctcgcagggcaaacattttagtgcaggcatggacctgtcagttttt
actcaaatgggtaaggactttgtgggtgagcctgctcgtcgaggtgagcgaatgcgtcgc
atggtgctcgaactgcaagacagttttaatgccctagaatccgttcgcatgcctgtatta
gtggcgatgcagggcggagtcattggtggtgcagttgacatggtttgcgcagcagacagt
cgttattgcaccgaagatacctacttcaccattaaagaaactgaaattggcatgaccgca
gatgtgggcacactacagcgtttaccgcatcttattcctcagggcttggtgcgcgaactg
gcttataccggccgtaacatgggcgctaaagaagccaaagagtctggtttagtgaatcaa
gtatttgctgatcaagaaagtttactcgcaggcgttatgaaaatagcggccaaaattgcc
agtaattcgcctctcgccgtagcgggttgtaaagagatgattaactacacccgtgaccat
accgtagcagatgcattgaactacatggctacatggcaaacaggtatgttccaaatgccg
gatatacaagaggccatgagcgcggcgaaagagcagcgcaaacccgtttacgaagaatta
cataagaatatcagtggtatgcagcgtaataagtaa

DBGET integrated database retrieval system