KEGG   Pseudoalteromonas atlantica: Patl_1404Help
Entry
Patl_1404         CDS       T00372                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pat00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1686808..1688181)
Genome map
AA seq 457 aa AA seqDB search
MKHVLRTSTKDRLKRTSLPLAIMLGVAIMSEAAVPPLNVSGNQIVTDGAPVSFAGNSLFW
SNTGWGGEKFYTAQAVANAKSEFGANIIRAAIGHGVNTAGSLNFDWDGNMSRLDTVVNAA
IEQDMYVIIDFHSHEAHTDQATAVRFFEEVANKYGTYDNVIYEIYNEPLQISWANDIKPY
AETLIDKIRAIDPNSLIVVGTPTWSQDVDVASQDPIDRANIAYTLHFYAGTHGASLRNKA
QTALNNGIALFATEWGTVNADGNGGVNANETDAWMAFFKANNISHANWALNDKDEGASTF
TPGGSWNSLTASGTKVKSIIKGWNSSVVNLDSDGDGVSDSDDQCDNTPTGTTVDIIGCAI
ADSDADGVSDITDQCPNTPQGTNVDATGCPQTTGSGIDCSAINSYPNWVQADYPGGTNNH
NDTGDQMQYQGNAYEANWYTNSLPGSDSSWVLLGSCG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgtgttacgtacatccaccaaagaccgtttaaaacgcacaagcttgcctctg
gctatcatgttaggagtagcaattatgagtgaggccgctgtacctcctcttaatgtcagt
gggaatcaaattgtgacagatggcgcccccgtgagctttgcaggtaacagtctattttgg
agtaataccggttggggtggcgagaaattctatactgcgcaagccgttgcgaatgcaaaa
tcagagtttggtgcgaacataatacgtgccgcaataggccatggtgtaaatacggccggt
agcttaaattttgactgggacggtaatatgagtcgcttggacacggtcgtaaacgccgct
attgagcaagatatgtatgtcattatcgactttcatagtcacgaggctcatacagaccag
gccactgcagtgaggtttttcgaagaagtcgccaataaatatggtacctacgacaacgtt
atttatgaaatctataatgagccattgcagatttcatgggccaatgacattaagccttat
gcagaaacgctaatcgataaaatacgtgcgattgatccaaatagcctgattgtggttggc
acgccgacctggtctcaagatgttgatgtggcctcacaagatcccattgatcgggcgaat
attgcctatacccttcacttttacgctggcacgcacggtgcgtcattgcgcaataaggca
caaacggctttaaataacggcatcgcactcttcgccacagagtggggaactgtcaatgct
gatggcaatggcggcgtaaatgcaaatgaaaccgatgcatggatggcttttttcaaagca
aataatattagccacgctaattgggcgctgaacgataaagacgaaggtgcttccactttt
acgcccggcggaagctggaattcattgactgcctcaggcacaaaggtgaagtcgattatt
aaagggtggaactcgagtgtcgtaaatttagacagtgatggtgatggagtaagtgacagt
gatgatcaatgtgataacacccccacaggtacaacagtcgatattattggctgtgcgata
gccgattccgatgctgacggtgtaagtgatatcacagaccagtgccccaacacaccacaa
ggcacaaatgtagatgctactggttgcccgcaaacaacaggcagtggcatcgattgcagt
gcaataaatagctaccctaattgggtgcaagcagattatcccggtggcacgaataaccac
aacgacacaggtgaccagatgcaataccaaggcaatgcttatgaagcaaattggtacact
aatagtttaccaggtagcgattcatcatgggtattgctaggtagctgtggttaa

DBGET integrated database retrieval system