KEGG   Pseudoalteromonas atlantica: Patl_1572Help
Entry
Patl_1572         CDS       T00372                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Patl_1572
Enzymes [BR:pat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Patl_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1879422..1880246
Genome map
AA seq 274 aa AA seqDB search
MNFRHKTLKLDSPKVMGILNVTPDSFSDGGQYALINKAIEHAAEMIASGADFIDVGGEST
RPGAADVAEQEELDRVVPVIEALQARFDTIISIDTSKAAVMKAAVNAGAGLINDVRALQE
PGALEVATTANVPVCLMHMRGQPRSMQDAPHYDNVFIDVQNFLLARAKVCIEAGMSKERI
LFDPGFGFGKSLNHNYQLLAQLETLHKLGYPLLVGMSRKSMIGQLLNRPVEERLAGSVAL
ATIAALKGAQIIRVHDVDETVDAIKIVSMLQKEK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcgtcataaaacattaaagcttgattcccctaaggtgatggggatcttaaac
gtcacgcctgattctttttcagacggtggtcaatatgcgttaataaataaggctattgaa
catgcagctgaaatgattgcatcaggggctgattttattgatgtaggtggtgaatccact
cgccctggggccgccgacgttgcagagcaagaagagctcgacagggtagtgccagttatt
gaagcccttcaggcgcgttttgatacaatcatttcaatcgataccagtaaggctgcggta
atgaaagccgctgtgaatgcaggtgcggggcttatcaatgacgtaagagcattgcaagag
cctggcgctttggaagttgctacaaccgccaacgtaccggtttgcctgatgcatatgcgt
ggtcagcctcgtagtatgcaggatgcgcctcattacgataatgtattcattgatgtgcaa
aattttttattggcccgagccaaggtctgtattgaggcgggtatgagtaaagaacgtatt
ttattcgatccaggttttgggttcggtaaaagcttgaaccataattatcagttacttgcg
cagttggaaactttacacaaactgggttaccccttattggtaggtatgtctagaaaatct
atgataggccagcttcttaatcgtccagtagaagaacgactagcaggcagtgtggcgctg
gcgactattgctgcgcttaaaggtgcgcaaattattcgtgtacacgatgtagatgaaacg
gttgatgcgattaaaattgtatctatgttacaaaaggaaaaataa

DBGET integrated database retrieval system