KEGG   Pseudoalteromonas atlantica: Patl_1574Help
Entry
Patl_1574         CDS       T00372                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00010  Glycolysis / Gluconeogenesis
pat00051  Fructose and mannose metabolism
pat00562  Inositol phosphate metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
pat01230  Biosynthesis of amino acids
Module
pat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pat_M00002  Glycolysis, core module involving three-carbon compounds
pat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_1574
   00051 Fructose and mannose metabolism
    Patl_1574
   00562 Inositol phosphate metabolism
    Patl_1574
Enzymes [BR:pat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Patl_1574
Exosome [BR:pat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Patl_1574
  Exosomal proteins of bladder cancer cells
   Patl_1574
  Exosomal proteins of melanoma cells
   Patl_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG40096
UniProt: Q15VJ2
Position
1881722..1882471
Genome map
AA seq 249 aa AA seqDB search
MQMNNRRPIVAGNWKMNGNLALIKQVEDAFSKADVSHVDVVVCPPFPYLGGFNDSNFALG
GQNISQYESGAHTGETAVSMLKEMKCQYVILGHSERRADNNESNELVADKVELALTHKLI
PLFCVGEPEDVRESGQLFDFIAAQIDAVINKVGIAAFNDIVIAYEPIWAIGTGKTASPEQ
AQEVHAFIRQHLAKQDSEIANQCVILYGGSVKGSNAVELFSQPDVDGGLIGGASLNPEDF
LSICLAAKR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaataaccgtcgacctatagtcgcaggtaattggaaaatgaatggcaacctt
gcgttaattaagcaagttgaagacgcattttccaaggctgatgtatctcatgtagatgtt
gtggtgtgcccaccgtttccttatttaggtggattcaacgacagtaattttgccttaggt
ggccaaaatatcagtcaatatgaatctggtgcgcatactggcgaaactgccgtaagtatg
ttgaaagaaatgaagtgccaatatgtcatattggggcattcagagcgacgtgctgataac
aacgagtcaaatgaattggttgccgacaaagttgagctggctttaacccataagctcatc
cctttattttgtgttggcgaaccagaagatgtgcgtgaaagcggacaactattcgatttt
atcgcggcacaaattgacgcggtaataaataaagtgggtattgcagcgtttaacgatatt
gttattgcctacgagcctatttgggcgattggaactggcaaaactgcgagtcccgaacaa
gcacaagaagtgcatgcatttatacgtcaacatttggcaaagcaagatagcgaaattgct
aaccaatgcgtgattttatacggtggaagcgtcaaaggcagtaatgctgttgaattgttt
tcacaacccgatgttgatggcggtttgattggcggagccagtttaaatccagaagatttt
ttaagcatttgcttagcggcaaagcgatag

DBGET integrated database retrieval system