KEGG   Pseudoalteromonas atlantica: Patl_1574Help
Entry
Patl_1574         CDS       T00372                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_1574
   01230 Biosynthesis of amino acids
    Patl_1574
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_1574
   00051 Fructose and mannose metabolism
    Patl_1574
   00562 Inositol phosphate metabolism
    Patl_1574
Enzymes [BR:pat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Patl_1574
Exosome [BR:pat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Patl_1574
  Exosomal proteins of bladder cancer cells
   Patl_1574
  Exosomal proteins of melanoma cells
   Patl_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1881722..1882471
Genome map
AA seq 249 aa AA seqDB search
MQMNNRRPIVAGNWKMNGNLALIKQVEDAFSKADVSHVDVVVCPPFPYLGGFNDSNFALG
GQNISQYESGAHTGETAVSMLKEMKCQYVILGHSERRADNNESNELVADKVELALTHKLI
PLFCVGEPEDVRESGQLFDFIAAQIDAVINKVGIAAFNDIVIAYEPIWAIGTGKTASPEQ
AQEVHAFIRQHLAKQDSEIANQCVILYGGSVKGSNAVELFSQPDVDGGLIGGASLNPEDF
LSICLAAKR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaataaccgtcgacctatagtcgcaggtaattggaaaatgaatggcaacctt
gcgttaattaagcaagttgaagacgcattttccaaggctgatgtatctcatgtagatgtt
gtggtgtgcccaccgtttccttatttaggtggattcaacgacagtaattttgccttaggt
ggccaaaatatcagtcaatatgaatctggtgcgcatactggcgaaactgccgtaagtatg
ttgaaagaaatgaagtgccaatatgtcatattggggcattcagagcgacgtgctgataac
aacgagtcaaatgaattggttgccgacaaagttgagctggctttaacccataagctcatc
cctttattttgtgttggcgaaccagaagatgtgcgtgaaagcggacaactattcgatttt
atcgcggcacaaattgacgcggtaataaataaagtgggtattgcagcgtttaacgatatt
gttattgcctacgagcctatttgggcgattggaactggcaaaactgcgagtcccgaacaa
gcacaagaagtgcatgcatttatacgtcaacatttggcaaagcaagatagcgaaattgct
aaccaatgcgtgattttatacggtggaagcgtcaaaggcagtaatgctgttgaattgttt
tcacaacccgatgttgatggcggtttgattggcggagccagtttaaatccagaagatttt
ttaagcatttgcttagcggcaaagcgatag

DBGET integrated database retrieval system