KEGG   Pseudoalteromonas atlantica: Patl_1635Help
Entry
Patl_1635         CDS       T00372                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Patl_1635 (malQ)
Enzymes [BR:pat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Patl_1635 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1945673..1947868
Genome map
AA seq 731 aa AA seqDB search
MTASLIDQLVEHRGIESNYTDAWGKPATIESTVKKKLLGVMGYNVDDQSALEEQVKQEMV
KDWLTPLNPVHVQRSNDSLSFCVRLPIELVTDEYSAQLTLESGEVIAHSFEPIDGELVNV
NHIDEIEFHEYYITIECNLPLGYHNLSLIVDGESLSEMRVIIAPHACYQPQTLLDGNKVW
GLSVQLYCLRSDDNWGVGDFSDLAYLTAEAAKTGADFIGLNPIHSLYPANPSACSPYGPS
SRRWLNFIYIDVAAVDGYEQVSTKAIVNAAEFQGAIQQARGSELVDYPVVTKLKLEALSA
VFDWQRQQYFTKNTTQNRAFKAFVEQGGESLQTIAVYDALQEDLALKGKASWGWPVFPPE
YADFNAPAVAKFAKANAKRVQFFLWLQWQAAQQFEKANKVAQDHNMQIGLYRDLAVGVSE
GSAEIWGNKALYCTEASVGAPPDILGPLGQTWGLPPMDPHKLYEQAYQPIIDLFSANMHA
TGALRIDHVMALLRLWWVPKGDSAKQGGYVYYPVDDLLAILALESHRNQSMVIGEDLGTV
PEEIREKLADNGVYSYRVFFFEQAKDGGFYSPSHYPVQSMSTLTTHDMPTLNGFWHCDDL
ALGKELGLYPTQEILASLYESRHDNKQSILDTLHGHHSISDEISGDVNQVGMTKGLNFGM
QTHMAGGSSSLLSLQLEDWLEMDKPVNIPGTFNEYPNWQRKLTQSLQQIFSNPELQALAH
RLTEVRRQAKQ
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttcattgattgatcagctcgtagagcatcgcggtattgagtcaaattacacc
gatgcgtggggtaaacctgccaccatcgaatcaacagtgaagaagaagctgttaggcgtt
atgggatataacgttgatgatcaatctgctctggaagagcaagtgaagcaagaaatggtc
aaagattggttaacaccgctcaatcccgttcatgtgcaacgcagcaatgattcgctttcc
ttttgtgtgcgcctacccatcgagttggtgaccgatgaatatagcgcgcaactcacattg
gaaagcggcgaagtaattgctcattctttcgagcccatcgacggtgaactggttaacgtg
aatcatattgatgagatagagtttcacgaatattacattacaatcgagtgcaacttgcct
ttgggttaccacaacctatcactaatagtagatggcgagtcgctgagcgagatgcgcgtc
attattgcgcctcatgcatgctatcaaccacaaacgttattagacggtaataaagtgtgg
ggtttgagtgtgcaactgtattgtctgcgcagtgatgataactggggagtaggggatttt
agcgacttggcttatttgaccgcagaggcagcgaaaaccggtgcggattttatcggctta
aaccccattcattcattgtatcctgccaaccctagcgcatgcagcccttacgggccctca
tctcgtcgttggttaaattttatttacattgatgttgctgccgttgacgggtatgagcaa
gttagcaccaaggctattgtgaatgctgctgagttccaaggggctatacagcaagcacgt
ggcagtgagttagtcgattatcccgtcgtgaccaaattaaaacttgaagcattaagcgcg
gtgtttgactggcaacgccagcaatattttactaagaacacgacccaaaaccgcgcattt
aaagcatttgtcgagcaagggggggaaagcctacaaaccattgctgtttatgatgcattg
caagaggatttagccttaaaaggcaaagcttcatggggatggcctgtcttccccccagag
tacgctgattttaacgccccagcagtggctaaatttgccaaagcgaacgctaaacgtgtg
caatttttcttgtggttacaatggcaggctgcccagcaatttgaaaaagccaataaagtc
gcccaagaccacaacatgcagattggtttgtatcgtgatttggctgtaggtgtcagtgaa
ggcagcgcagagatttggggaaacaaagcgttgtactgcactgaggcaagtgtgggagcg
ccaccagatattttagggccgcttgggcagacatggggattgccacctatggatccgcac
aaattatacgagcaagcgtatcaaccgatcatcgatttgttcagtgcaaatatgcatgct
accggcgctttacgcatcgatcacgtgatggcacttttgcgattgtggtgggtgcctaaa
ggggatagcgctaagcaaggaggctatgtttattatcctgtggatgacttacttgcgatc
ttggcactagaaagccatcgcaatcaatctatggtgataggtgaagatttaggcacagtg
ccggaggaaatccgtgaaaagctggccgataatggcgtttattcttatcgcgtgttcttt
ttcgaacaagccaaagatggcgggttctattcgcctagtcattatccggtgcaatcaatg
tcgacgttaaccacgcacgatatgcctaccttaaatggcttctggcattgcgacgatttg
gcgttaggcaaggaactaggcttgtatccaacacaagagatccttgcaagcttgtacgag
agcagacatgataacaaacagtctattttagataccttgcatggtcatcattctatttct
gatgaaatcagtggagatgtgaatcaagtgggtatgaccaagggactcaattttggtatg
caaacacacatggctggcggttcgagctctctgctcagtttacagctagaagattggtta
gaaatggataaacccgttaatattccgggtacatttaatgaatacccgaattggcaacgt
aaactgactcaaagtttacaacagatttttagcaaccctgagctacaagcgttagctcat
cgcttgacagaggtaagacgtcaagcaaagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system