KEGG   Pseudoalteromonas atlantica: Patl_1664Help
Entry
Patl_1664         CDS       T00372                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_1664
   01212 Fatty acid metabolism
    Patl_1664
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Patl_1664
   00650 Butanoate metabolism
    Patl_1664
  Lipid metabolism
   00071 Fatty acid degradation
    Patl_1664
   01040 Biosynthesis of unsaturated fatty acids
    Patl_1664
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Patl_1664
   00310 Lysine degradation
    Patl_1664
   00380 Tryptophan metabolism
    Patl_1664
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Patl_1664
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Patl_1664
   00281 Geraniol degradation
    Patl_1664
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Patl_1664
   00930 Caprolactam degradation
    Patl_1664
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Patl_1664
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Patl_1664
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Patl_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1982543..1984696
Genome map
AA seq 717 aa AA seqDB search
MTTENSTQQLAPSAFTLTKRDDGIAILSMDVPGETMNTLKVEFGEQVGDMLDQIQSDSAI
KGVVVISGKDNSFVAGADISMLAGCKSAEEAEAIGKGGQAVFQRIEDMAVPFVAAIHGPA
LGGGLELALACHMRVCSDDNKTQLGLPEVQLGLLPGSGGTQRLPRLISVQQAMKMMLTGA
SVRAKQAKKYGIVDDMVPRSILLEVAIEMAKKPKPNRKPVKLDAMGQFLERTPMGRKLMF
KQARKQTQAKTMGNYPSPERIIDCIETGLEKGKAQGFAVEAKHFGHLVMTSESAALRSLF
FATTEMKKENGVEGVAPKTLKKIGVLGGGLMGGGIAFVTATKAKLPARIKDIRSDGIAHA
MKYSYDILNKKVKRKFMLHSEMQSQLSRLTGSVDYVGFDNTDVVIEAVFEDLALKQNMVA
DVEEHCSEHTIFASNTSSIPIGQIAAKAKRPENVIGLHYFSPVDKMPLAEVIAHEATSDQ
TISTTVELAKKQGKTPIVVKDGAGFYVNRILAPYMNESAEILLAGEPIEQIDKALVKFGF
PVGPIKLLDEVGIDVGTKIGPILVAEFGERFQSAPGFDKLLADDRKGKKNKRGFYNYEGK
KPGKEVDESVYDLLGITPNSRLSEHTIAERCVLLMLNEAAICLDEGVVRNPRDGDIGAIF
GIGFPPFLGGPFRYMDTLGINHVVERLTHYQQQFGDKFAPAKRLLDMAESKDTFYPK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatagtacccaacaacttgcccctagcgcgtttaccttaaccaagcgt
gatgatggcatcgcgattttgagtatggatgtgccaggggaaaccatgaatacgctcaaa
gtggagtttggtgagcaagtcggtgacatgcttgaccaaattcaaagtgatagcgctatt
aaaggcgtggtagtgatcagtggtaaagataactcgtttgtggccggtgctgatatctct
atgctcgcaggatgtaaaagtgcagaagaagctgaagcgattggaaaaggcggacaagcg
gtattccaacgtatcgaggatatggcagtgccatttgtcgctgcgatccacggccctgct
ttgggaggcgggcttgaactggcgttggcgtgtcacatgcgagtatgtagtgacgacaat
aagacgcagctgggcttacctgaagtacagcttggtcttttacccggtagtggtggcacg
caaagactcccgcggttaattagcgttcaacaagcaatgaaaatgatgctcacaggggcc
tcagtacgagcaaaacaagccaaaaaatacggtatcgttgacgatatggtgccgcgttct
attttgcttgaagtcgcgattgaaatggcgaaaaaacctaagccgaatagaaaaccagta
aagcttgatgcaatggggcagtttcttgaacgtacccctatgggccgaaaactcatgttt
aaacaagctcgcaaacaaactcaggctaaaacaatggggaattatccctcacctgagcgc
attattgattgtatcgaaacgggattagagaagggaaaagcccaaggttttgctgtggaa
gctaagcattttggtcatctggttatgacgtctgaatcagctgctttacgtagtttgttt
ttcgcgaccaccgaaatgaaaaaagaaaatggcgtggaaggagtagcgcctaaaacactg
aagaaaatcggcgtgttaggcggtgggttgatgggcggtggcattgcgtttgtgacggca
accaaagctaaacttccggctcgaatcaaagatatccgcagcgatggcatcgcgcatgcg
atgaaatattcctacgatattttgaacaaaaaagtgaagcgcaagtttatgctgcactca
gaaatgcaatctcagttatcacggctaacaggctctgttgattatgttgggtttgataac
accgatgtggtgattgaagcggttttcgaagatttagcgttgaaacaaaatatggttgcg
gatgtggaagagcattgctcagagcatacgatttttgcttcgaatacatcttctatcccc
ataggtcaaattgccgctaaggcgaagcgccctgaaaatgttattggtttacattatttt
tcaccggtagataagatgcccttggcagaagttattgcgcatgaagccacctctgaccaa
acaatatccactacggttgagctagcgaagaagcaaggtaaaaccccgatcgttgtaaaa
gacggcgcaggtttttatgttaatcgaattttagcgccatatatgaatgaatctgctgaa
attctattggctggtgagcccattgagcagatagataaggcgttagtcaaattcggtttc
cctgtgggacccatcaaacttttagatgaagtgggtattgatgttggcactaaaatagga
ccaattttggttgctgagttcggtgagcgattccagtcagcgccaggttttgacaaatta
ttggcggacgatcgaaaaggtaagaagaacaagcgtggtttttataactatgaaggtaaa
aagcctggcaaagaagtcgatgaaagcgtttatgatctacttggcattacgcctaatagc
cgcttgagcgagcatactattgccgaacgttgtgtgttactcatgcttaatgaggccgct
atatgtcttgacgaaggtgttgtgcgtaatcctagagacggtgacataggtgcgatattt
ggtatcggctttccaccattcttaggcggcccgtttagatacatggataccttaggcatt
aaccacgttgtggaacgattaacgcattatcagcagcagttcggtgacaagtttgcgcct
gctaagcgccttttagacatggcagaaagtaaggatacgttttacccgaaatag

DBGET integrated database retrieval system