KEGG   Pseudoalteromonas atlantica: Patl_1716Help
Entry
Patl_1716         CDS       T00372                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pat  Pseudoalteromonas atlantica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pat00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pat00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2051327..2052325
Genome map
AA seq 332 aa AA seqDB search
MLDVSGYELTPEDRELLDHPLVGGVILFSRNYYDQKQLKELIAQIRLAARNKILIGVDHE
GGRVQRFRDGFSAIPAMGAICARSDEGLSQAQQYCNTFGWLMAAECLAFDIDLSFAPVLD
LNGVSDVIGDRSFHTQPEPLIQLASEFIKGMHRAGMKATGKHFPGHGNVKEDSHVAMPVD
NRSLEQITQLDMQIFSRLNDMGLLDGVMPAHVVYSQVDDMPAGFSKVWLQTYLRQKMQFD
GVVFSDDLSMQGAAFIGDFAARANAALNAGCDMVLVCNNPDAAAQVIDSLPSDLPTNPRL
AKLAKAPCADFNALVKTDAYTAAQRTLEAYNN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtctcaggttacgagttaacacctgaagacagagagttgctcgatcatcct
ttagtgggtggcgttatccttttcagtcgtaactactacgatcaaaaacaactaaaagag
ctcattgctcaaattcgattggcagcacgcaacaagatattaattggggtggatcatgaa
ggcggccgggttcagcgttttcgcgacggattcagcgctattcctgcaatgggtgctatt
tgcgcccgcagtgatgagggtttgagccaggcacagcaatactgcaatacttttggttgg
ctcatggcggctgaatgcctcgcatttgatatcgacttaagttttgcgcccgtgctcgat
ttaaacggcgtatcggatgttattggtgatcgctcttttcatacccagccagaacctctg
attcaacttgccagtgagtttattaaaggcatgcaccgagcagggatgaaagccacaggt
aaacattttcctgggcatggtaatgtcaaagaagactcgcatgttgcgatgccggtagat
aatcgaagtcttgaacaaatcactcagctagatatgcagatttttagccgcttaaacgac
atgggcttacttgatggggtgatgccagcgcatgtggtgtactctcaagtggatgatatg
ccagcaggtttctctaaagtctggttacaaacctacttgcgccaaaaaatgcaattcgac
ggtgtggtattttccgatgatttgtcgatgcagggagccgcgtttattggcgactttgcc
gccagagcaaatgcggcactaaacgctggctgcgatatggtgctggtatgtaataacccc
gacgctgctgcgcaggtcatcgatagcttacccagtgatttacccacaaatccgcgttta
gcaaagcttgccaaagcgccctgtgctgactttaacgcactggttaaaacagatgcttac
acagcggcccagcgcactctcgaagcatataacaattag

DBGET integrated database retrieval system