KEGG   Pseudoalteromonas atlantica: Patl_1758Help
Entry
Patl_1758         CDS       T00372                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Patl_1758
Enzymes [BR:pat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Patl_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2108316..2110529
Genome map
AA seq 737 aa AA seqDB search
MVSKLMIKNDVSTPQSQQTQVQASPEPPTTASILQSLLSVGRIRPLDVAFAEFIMLHERN
KLAVNTAGIHALGLLAAYLSSRLGEQDSCLNLDGFYQPFLPFYRFDSAPVLMSILEASSC
VSVVEEPRFNQASDAVAGSDTRSDTGNNTSSHDRYSSAQHLPAQQLSAKQLHTHQAQEHQ
SQSKPLILQGHELYMQRYWQYEVQLAEKINSMTGRTSTLDIEQGRALLGQLFVSAPDDVG
DERDLNDVNRQSGHGHAQREPEIDWQKVAVCLAASQSVSVITGGPGTGKTTTVIRLMALL
QGLARHKGKKLQIKLAAPTGKAAARLSQSISAAMDKLPDALKPDLPSQCSTIHRLLGSIP
NSPYFRFNQQHPLHVDVLIVDEASMVDLPLMSKLFAALPRHAKIVLLGDKDQLASVEAGS
VLSDICSAALNFSPTVFNQSPPYSDQALGVVKDLCQIELNINTLNKAPISNSLALLHKSY
RFSEKSGIGRLARAINMGRLANAKALFSDDVYQDVVWQTSDDPKALVNRLLPDYQRYFER
VRQVCARGTLSTQGIEVFALLQQQQVLCAQKEASWGVKQMNVLIESELNKHGAIELGRDF
YIGRPVMLKQNDHSLGLFNGDIGIAMPDEENEGLMKVWFVTEQNTLRGVLPSRLPPHDTV
YAMTIHKSQGSEFDHVYLCLPRIETRSQARLLSRELLYTGLTRAKKSFNLYSDEQALSIS
VARRCQRGSGLAKRLLP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaaattgatgataaaaaatgatgtatcaaccccacagagtcagcaaacacaa
gttcaggcatcaccggagccgcccacgactgccagtattctacaaagcttgttgagtgta
ggtcgaattcgcccattggacgtggcatttgctgagtttattatgcttcacgagcgtaat
aaattggcggtaaacaccgctggcattcacgcgctgggtttactcgctgcttatctcagc
agccgattgggcgagcaagatagctgcctcaatctcgatggattttatcagccattttta
cccttttatcgtttcgattctgcgcctgtgcttatgtctattttagaggcatctagctgc
gtttcggtagttgaagagccgcgctttaatcaagcatctgatgctgtggccggttcagat
acccgttctgatacaggtaacaatacttcatcgcatgatcgttattcttcggcccagcat
ttaccggcccagcagttatcggccaagcagttacacactcatcaggcgcaggaacatcag
tctcaaagtaagcctttgattttacaggggcatgaactttacatgcagcgttattggcag
tacgaagtgcaactggcagaaaaaataaacagcatgacagggcgcacgagtaccttagat
attgaacagggcagagcattgctagggcaattgtttgtttcagcacccgatgatgtaggt
gatgaaagagaccttaatgatgtaaaccgtcaaagtggtcatggccacgcccagcgggag
cctgaaatagattggcaaaaagtggcggtgtgtcttgcggcgagccaaagcgtgagtgtg
atcaccggtggaccagggacagggaaaacaaccactgtgatccggttgatggctctttta
cagggcttggcgcgacataaaggcaaaaaactgcaaattaaactggctgcgccaacagga
aaagccgctgcgcgtttgagccagtctatcagtgccgccatggacaaactaccggacgcc
ttaaagcctgatttacctagtcagtgcagcactattcataggttattgggcagtattcca
aatagcccttattttcgctttaaccagcaacaccccttgcacgtcgatgtgctgatagtg
gatgaagcgtccatggttgatttacccttaatgagtaagctatttgcggctttgcctagg
catgcaaagattgttttattaggtgataaagaccaactcgcttcggtagaggcgggcagt
gtgctgtctgatatctgttctgcggcattgaatttttcgcccactgtcttcaatcaatcc
ccgccatacagtgatcaagcacttggtgtggtaaaagacctgtgccagattgagttaaac
atcaataccctaaataaggcgccgattagcaatagccttgccttgctgcacaagagttat
cgtttcagtgagaaaagtggtattggccgcttagcgcgggctattaacatggggcgattg
gcgaatgccaaagcattattttcagatgatgtttaccaagatgtagtatggcaaaccagt
gatgatccaaaagccttggtgaatagactgctgccggattaccaacgatatttcgagcgc
gtaaggcaggtctgcgcccgaggaacccttagcacgcagggtattgaggtctttgcgtta
ttacagcaacaacaagtcttgtgcgcgcaaaaagaggcgagttggggcgtaaagcaaatg
aatgtcttgattgagtctgagctgaataaacacggagccattgaactaggtcgagatttc
tatattggccggcccgttatgcttaagcaaaacgaccatagtttaggcttgtttaatggt
gatattggtattgccatgcctgacgaggaaaacgaaggtctgatgaaagtgtggtttgtt
actgagcaaaacaccttgcgtggggtgttgcccagtcggttacctccccatgatacggtt
tacgccatgacgatacacaaaagccaagggtctgagtttgatcatgtttatttgtgcttg
ccacgcattgaaacgcgctctcaagcgagattgctcagccgagagctgctgtacactggc
cttacgcgggcgaagaaatcgttcaacttgtatagtgacgagcaggccttgtcgatcagt
gtggcaaggcgttgtcagcgagggagtgggctagctaagcgtttactcccgtaa

DBGET integrated database retrieval system