KEGG   Pseudoalteromonas atlantica: Patl_1796Help
Entry
Patl_1796         CDS       T00372                                 

Definition
putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pat  Pseudoalteromonas atlantica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_1796
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Patl_1796
   00650 Butanoate metabolism
    Patl_1796
  Energy metabolism
   00190 Oxidative phosphorylation
    Patl_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2155324..2155671
Genome map
AA seq 115 aa AA seqDB search
MLTNQANFKRDGVQDYVTVRATAIIMTAFTLYMLWFFLSTPTVTYEIWHELFSSLGMKVF
TFAALVSVMLHIRIGFWQVLTDYVKSTALRAVVQFFINLVAFVYVAVGLFVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctaactaaccaagctaactttaagcgtgacggcgttcaggattacgttactgtgcgt
gccactgccatcatcatgactgcgtttactttatacatgctgtggtttttccttagcacc
ccaacagtgacctatgagatctggcacgagttgttttcttctttaggcatgaaagtattc
acttttgcagcgttagtgtctgtgatgctgcacattagaattggtttttggcaagtgcta
accgattacgtcaaatcaacagcccttcgcgctgttgtgcaattttttattaacctagtg
gcgtttgtctatgttgctgtaggtttatttgttttgtggggtctataa

DBGET integrated database retrieval system