KEGG   Pseudoalteromonas atlantica: Patl_1796Help
Entry
Patl_1796         CDS       T00372                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00020  Citrate cycle (TCA cycle)
pat00190  Oxidative phosphorylation
pat00650  Butanoate metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
Module
pat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pat_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Patl_1796
   00650 Butanoate metabolism
    Patl_1796
  Energy metabolism
   00190 Oxidative phosphorylation
    Patl_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS TMEM40
Motif
Other DBs
NCBI-ProteinID: ABG40317
UniProt: Q15UX1
Position
2155324..2155671
Genome map
AA seq 115 aa AA seqDB search
MLTNQANFKRDGVQDYVTVRATAIIMTAFTLYMLWFFLSTPTVTYEIWHELFSSLGMKVF
TFAALVSVMLHIRIGFWQVLTDYVKSTALRAVVQFFINLVAFVYVAVGLFVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctaactaaccaagctaactttaagcgtgacggcgttcaggattacgttactgtgcgt
gccactgccatcatcatgactgcgtttactttatacatgctgtggtttttccttagcacc
ccaacagtgacctatgagatctggcacgagttgttttcttctttaggcatgaaagtattc
acttttgcagcgttagtgtctgtgatgctgcacattagaattggtttttggcaagtgcta
accgattacgtcaaatcaacagcccttcgcgctgttgtgcaattttttattaacctagtg
gcgtttgtctatgttgctgtaggtttatttgttttgtggggtctataa

DBGET integrated database retrieval system