KEGG   Pseudoalteromonas atlantica: Patl_1800Help
Entry
Patl_1800         CDS       T00372                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_1800
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Patl_1800
  Amino acid metabolism
   00310 Lysine degradation
    Patl_1800
Enzymes [BR:pat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Patl_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2161176..2162663
Genome map
AA seq 495 aa AA seqDB search
MSIDIKVPVLPESVADASIATWHVKVGEQVTRDQNLVDIETDKVVLEVVAPADGVLSDIL
DEEGATVLGEQIIAKFEEGAGASQAKEQSAPAAEKTSSNKGESVEIKVPVLPESVADATV
ATWHVQPGESVSRDQNLVDIETDKVVLEVVAPADGTLSDILAQEGETVMGEQVIANFAAG
AAPAKAEATAAASSDTGGSDNDALSPSVRRLLAEKGIDAASIKGTGKGGRVTKEDVEKSL
SAPAKSAAPAKADAPATPSLGGERSEKRVPMTRLRKTIASRLLEAKNSTAMLTTFNEVNM
KPIMELRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASLDGDDICYHNYFDVS
IAVSTPRGLVTPVLRDCDTLGMAGIEGGIKALALKGRDGKLSMADMQGGNFTITNGGVFG
SLLSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGKESVGFLVT
IKEMLEDPTRLLLDV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagatattaaagtaccggtattgccagaatctgtggccgatgcatcaattgcc
acttggcatgtgaaggtaggtgaacaggttactcgcgatcaaaacttggtcgatatcgaa
accgataaagtggtacttgaagtggttgctcctgcagatggcgtattaagcgacatccta
gatgaagaaggtgcaacagtactaggcgagcagataatcgcaaaatttgaagaaggggct
ggcgcatctcaagcaaaagagcaaagtgcaccagcagcagagaaaacatccagtaataaa
ggtgagtcagtggagattaaagtacctgttctgcccgaatcagtggcagatgcaaccgta
gcaacatggcatgttcaaccaggcgaatcggtctctcgtgaccaaaacttggtagatatt
gaaaccgataaagtggttttagaagtggttgctccagccgatggcaccttgagtgacatt
ctcgctcaagaaggcgaaacggtaatgggtgagcaagtgattgctaattttgctgcaggc
gctgcgcccgctaaagctgaagccactgctgccgctagtagtgatacaggcggttcagac
aatgacgccttaagcccttcagtacgccgtctattagctgaaaaaggcattgatgctgcg
agcatcaaaggtacaggtaaaggcggtcgtgtgactaaagaagacgttgagaaatcattg
tctgcgccagctaagagtgcagcaccagcaaaagctgacgcaccggcgacgccttcacta
ggcggtgagcgttctgaaaaacgtgtacctatgacacgtcttcgtaagacaatcgcgagt
cgtttgcttgaagcgaaaaactctacggctatgttgacaacgttcaacgaagttaatatg
aagcctatcatggaattacgtaagcaatatcaagagtcgttcgagaaacgtcacggtatt
cgtttaggtttcatgtctttctacgttaaagcagtaacagaagcgcttaaacgcttccca
gaagtgaatgcgtctcttgacggtgatgatatttgttaccataactacttcgatgtatcg
attgcagtgtctactcctcgcggtttggttacacctgtattgcgcgattgcgatacactg
ggtatggctggtatcgaaggtggcatcaaagcacttgcacttaaagggcgtgacggtaaa
ttgtcaatggctgatatgcaaggtggtaacttcactatcactaatggtggtgtgtttgga
tcattgctttcaacccctattattaatccaccacagagcgctatcttgggaatgcataaa
atccaagatcgtcctatggcggtgaatggcaaagtagaaattttgcctatgatgtattta
gcactttcttatgatcatagaatcatcgacggtaaagagtctgttggtttcttagttacg
atcaaggaaatgttagaagatccaacgcgtctgctactggatgtttaa

DBGET integrated database retrieval system