KEGG   Pseudoalteromonas atlantica: Patl_1801Help
Entry
Patl_1801         CDS       T00372                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00020  Citrate cycle (TCA cycle)
pat00640  Propanoate metabolism
pat00660  C5-Branched dibasic acid metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
Module
pat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Patl_1801
   00640 Propanoate metabolism
    Patl_1801
   00660 C5-Branched dibasic acid metabolism
    Patl_1801
Enzymes [BR:pat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Patl_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABG40322
UniProt: Q15UW6
Position
2162787..2163956
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSEGYAAETPQAAVEAADRIGGTEWVVKCQVHAGGRGKAGGV
KLVKNKDEIKAFAQKWLGQNLVTYQTDEAGQPVSKILVESCTDIAQELYLGAVVDRASRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPLVGAQPYQAREIAFKLGLKGVQIKQFTQI
FMGLAKLFEEKDIALIEVNPLVIKDDGNLHCLDAKVAMDSNAAYRQPKLQEMHDPSQEDA
REAQAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGSPANFLDVGGGATKERVAE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTIPVVVRLEGTNAELGRDV
LANSGLDIIAASSLTDAAKQVVKAAGGAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcagggtaaacaattattcgctgaatacggtttacctgtatct
gaaggatatgctgcggaaactccgcaggcggcagttgaagctgcagatcgtattggcggt
actgaatgggttgtgaaatgtcaggttcacgctggtggtcgcggtaaagcaggtggcgtt
aagcttgttaaaaacaaagatgaaatcaaggcatttgctcaaaaatggcttggtcaaaat
ttggtgacttatcagacagatgaagctgggcaaccagtaagcaaaatcttggttgaaagc
tgtacagatattgctcaagaattgtacctaggtgcagttgttgaccgtgcttctcgtcgc
gtagttttcatggcatctaccgaaggtggtgttgaaattgagaccgttgctgaagaaaca
cctgaaaaaattcttaaggctgagatcgatcctctagtaggtgctcaaccttaccaagct
cgcgaaatcgcgtttaaacttggtcttaaaggcgttcaaatcaaacagtttactcaaatc
ttcatgggtttggctaaattgttcgaagaaaaagacattgcactaatcgaagtaaacccg
cttgttattaaagacgacggtaaccttcattgtcttgacgcgaaagtagcgatggacagc
aacgctgcatatcgtcagcctaagcttcaagaaatgcacgatccttcacaggaagatgca
cgtgaagcacaagcggctaagtgggaacttaactacgtagcacttgatggcaacatcggt
tgcatggttaatggtgcaggcctagcaatgggcactatggacatcgttaacttgcacggt
ggctcaccagctaacttcctagatgttggcggcggtgcaaccaaagagcgtgttgctgaa
gcattcaaaatcatcctttctgattcaaatgttgcagccgttttggttaacattttcggt
ggtatcgtgcgttgtgacatgatcgctgaaggtattatcggtgcagttaaagaagtgggt
gtaaccattcctgttgttgtacgtttagaaggtacaaacgcagagcttggccgtgatgta
ttggctaactcaggtttagatatcatcgccgcttctagcttaacggatgctgcgaaacaa
gttgttaaagctgccggaggtgctgcatga

DBGET integrated database retrieval system