KEGG   Pseudoalteromonas atlantica: Patl_1976Help
Entry
Patl_1976         CDS       T00372                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00072  Synthesis and degradation of ketone bodies
pat00650  Butanoate metabolism
pat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Patl_1976
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Patl_1976
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Patl_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 DUF1776 3HCDH_N Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABG40494
UniProt: Q15UE4
Position
complement(2400552..2401337)
Genome map
AA seq 261 aa AA seqDB search
MNNSHAIKHRTILITGGASGIGLGIAQQLGSNGHKIVIADMNMDAAENAVAELGAQGISA
RALLLDVTNQEHINNLSANLAPDTVDVLINNAGIQHVAKLEEFPGDKWQQLINIMLVAPA
MLTQALLPTMRSKNYGRIINIGSVHSLIASPYKSAYVAAKHGLLGFSKTLALETGDCDVT
INTLCPAYVKTPLVEKQIAAQAKEHGMSEEDVINKIMLEPMPKKSFIDIDELASSAAFLM
DNSARNITGQTIVIDGGWTAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactcacacgctataaaacacagaacgattctgatcactggcggcgctagcggg
attggtttagggatagcccaacaattgggcagcaacggccataaaatcgttatcgcagac
atgaatatggatgcggctgaaaatgccgtcgcagaactaggggcacaggggatcagcgca
cgcgcccttttacttgacgtcacaaatcaagagcatatcaataaccttagcgctaacctt
gctcctgacacggtagatgttttaattaacaacgcaggtattcaacatgttgccaaacta
gaagaattccctggggataaatggcagcaattaatcaatattatgctggtggcgcccgcc
atgttgacgcaagcgttactgcccaccatgcgcagtaaaaactacggccgaattattaat
attggctctgtacattcccttattgcgtccccttataaatcggcatatgtagcggcaaaa
catgggttgcttggcttttcgaaaacactggcactggaaacgggtgattgtgatgtcaca
atcaacacactttgccccgcttatgtcaaaacacctttagtggagaaacaaatagcagcc
caagccaaagaacatggtatgagcgaagaagatgttatcaataaaatcatgctcgaaccc
atgccgaaaaagtccttcattgatattgatgagctggccagcagcgccgcttttttaatg
gacaacagcgcgcgtaatattactggacagaccatcgttatagacggcggctggacggcg
cgttaa

DBGET integrated database retrieval system