KEGG   Pseudoalteromonas atlantica: Patl_2081Help
Entry
Patl_2081         CDS       T00372                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Patl_2081
   00565 Ether lipid metabolism
    Patl_2081
   00590 Arachidonic acid metabolism
    Patl_2081
   00591 Linoleic acid metabolism
    Patl_2081
   00592 alpha-Linolenic acid metabolism
    Patl_2081
Enzymes [BR:pat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Patl_2081
    3.1.1.32  phospholipase A1
     Patl_2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525209..2526099
Genome map
AA seq 296 aa AA seqDB search
MLKQMELSADEITLGEIRALCSQDSANRVQKRDRLEHRASLNPFALLPHKPNYLLPVTFA
NISKRPYEGDPKAEKYQDTEAKFQISLKYLAVEDLMWDGLDVQVAFTVASYWQAYNGEIS
APFRETNYEPEIIFNYSRPWSLLGLPIEQTFVSLNHQSNGQTGELSRSWNRIIGGVVFAQ
NANVTWGLRTWWRIPEEDKQSFDDPDGDDNPYIERYMGYGEIGGVWSISDNHTLELLLRN
NLRSDNRGAVQLGWTFPITRHLRGYVEYFNGYGESLIYYNQHTQRLGLGVKLTNWL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaatggaattatctgccgatgaaataacgctcggggagatacgagcactc
tgctcacaagacagcgccaaccgtgtgcagaaacgagatcgcctcgaacatagagcgtca
ctcaatccatttgcgctcttacctcacaaaccgaattacttattacccgttacttttgcc
aatatcagcaagcggccctacgagggagatcctaaagctgaaaaataccaagacacagaa
gcaaaatttcaaatctctttgaaatatttagcggttgaagatttaatgtgggatggactt
gatgtacaagttgcctttacggtcgctagctattggcaagcttacaatggggagatatcg
gcaccatttcgagaaacaaattacgagcctgaaattatttttaactatagccgtccatgg
agtttgctcgggttaccgatagagcaaactttcgtatcgctaaaccatcaatctaatggt
caaacaggcgagttatccagaagttggaatcgtattattggtggtgttgtttttgcgcag
aatgcgaatgtcacttggggtttacgaacatggtggcgaataccagaagaagataagcag
tcttttgatgatccagacggagacgacaacccgtatatcgagcgctacatggggtatggt
gaaattggcggagtatggagtatatctgacaatcacaccttagaactcttgttgagaaat
aaccttagaagtgataatcgcggcgcagtgcaactgggttggacctttccaatcactcgt
catctcagagggtatgtggagtacttcaatggatacggagaaagcttaatctattacaat
caacatactcaacgcttgggtcttggggttaaacttaccaactggttataa

DBGET integrated database retrieval system