KEGG   Pseudoalteromonas atlantica: Patl_2087Help
Entry
Patl_2087         CDS       T00372                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_2087
   01230 Biosynthesis of amino acids
    Patl_2087
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_2087
   00030 Pentose phosphate pathway
    Patl_2087
   00051 Fructose and mannose metabolism
    Patl_2087
   00052 Galactose metabolism
    Patl_2087
  Energy metabolism
   00680 Methane metabolism
    Patl_2087
Enzymes [BR:pat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Patl_2087
Protein phosphatases and associated proteins [BR:pat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Patl_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2532086..2533204)
Genome map
AA seq 372 aa AA seqDB search
MALLTHNNLRVGILTGGGDCPGLNAAIRSVAKTLMLTSNAEIVGIEDGFLGFIERRSRPI
SYQDCSGIFALGGTIIGTCNRADPFNYKGKDCSGEVKAYYDLLQLDALVIIGGDGTLSIG
YELSKLGINVVGVPKTIDNDLMCTERTFGFDTAVSIVTDAIDRLRTTGQSHKRIMIVETM
GRNAGWIALHAGVAGGADSILIPEYPYDIQRVAKACTERMGSHHFSIVVVAEGARPVNGQ
VSVRENIVDSPEPSRLGGIGEQLKVQLGEFMDAEIRATTLGHIQRGGSPTSFDRVFATNL
GSYAAKLVESKQFNRAVIQKGNRLSHVALESVANKTRNVPVDDLTLQTAIAMGICFGTPD
LTPNTSRDLILD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgttactaacccacaataacctgcgcgttggaatattgaccggcggtggcgactgt
cctggtctaaacgcggcgatacgtagtgtcgcgaaaacacttatgctgacatcaaacgct
gaaatcgtaggcattgaagatggatttttaggctttattgagcgtcgtagtcgacccata
agctatcaagattgcagtggaatctttgcgttaggcggtacgataatcggtacctgtaac
cgtgcagatccctttaactataaaggcaaagactgctctggtgaggttaaagcctattac
gatctactgcaattagatgctctggttatcataggcggagatggtacgttaagtattggc
tatgagctgagcaaattaggcatcaatgtcgttggcgtccctaaaaccatagataacgac
ttgatgtgtactgagcgaacatttggttttgacacagcggttagtattgttaccgatgct
attgaccgtttacgcaccacaggacaatctcataagcggatcatgattgttgaaacaatg
ggacgtaacgccggttggatagcccttcatgctggagttgcagggggtgcagacagcatt
cttatacctgaatatccttacgatatacaacgtgttgccaaagcgtgcactgaacgtatg
ggctcccatcacttttctatcgtggtggttgcagagggagcaaggccagtcaatggccaa
gtaagcgtaagagaaaatattgtggatagtccagagccttcccgattaggggggatcgga
gaacaattgaaggtgcaattaggcgagtttatggatgcagagatacgagcaactacctta
ggccatattcagcgtggcggctcccctacatctttcgatagagtatttgccactaatttg
ggcagttatgccgccaaattagtggaaagtaaacaattcaaccgcgctgtgatccaaaaa
ggcaatagactttcccacgtcgcacttgagagcgtggcaaacaagacgcgtaatgtacct
gttgatgacttaacacttcaaaccgctatcgcgatgggaatttgcttcggcaccccggac
ttgacacccaacacaagtcgagacttaatattggactaa

DBGET integrated database retrieval system