KEGG   Pseudoalteromonas atlantica: Patl_2164Help
Entry
Patl_2164         CDS       T00372                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pat00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2612143..2613903
Genome map
AA seq 586 aa AA seqDB search
MQSTYDQLAELVEHHLAVIYNEVELSVTYQTFAQDLLTTMGFEKDVSIAPPLRHHNNWTQ
EDAVLITYGDSIESPGEKPLTTLYTFLNECCAKNLNSVHILPFFPYSSDDGFSVIDYSSV
NEALGDWEDIKRIATDFRLMSDVVINHCSSRSAWFDNFIKGEGPGSDFFYTASPDEDLSN
VVRPRTSPLLRETETAKGIEHVWCTFSHDQVDFDFRNPKVLETFVSIIRQYLDNGVRLFR
LDAVAFLWKKLGTPCINLEQTHEVVRLLRTLIEHAQPDVIIITETNIPNRENLAYLGNAN
EAHAIYNFSLPPLLVNTLITGDCHYLKSWLMSMPPAQNGTTYFNFIASHDGIGLRPAEGL
LEDEELTVLVNTMQNFGGRISWRASENGQQKAYEINIALYDALQGTTKGTDKWGFQRFMC
AHAIMLGLEGIPGIYIHSLLATGNDYERVKNTSHNRAINRHKWQYTELQKQLASPYSQHQ
RVLKAMGELLTIRRQQVAFHPNATQFTLQLGSKVFGFWRQSIDRRQSIFCISNICDEIQE
IHLSDINLVGTDEWIDLMTQQPIYAADSFIELAPYQTMWISNLPKR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtacttatgaccaattagccgagttagtcgaacatcatttggctgttatttac
aatgaggttgagctgagtgttacctatcaaacattcgcccaagatctgttgactacgatg
gggtttgaaaaggacgtatcaatcgcacctcctttacgccaccacaataattggacgcaa
gaagatgccgtgctgatcacttatggcgattcaattgaatcgcctggggagaagccatta
acgaccctttacacctttttaaatgaatgctgtgcgaagaacttgaacagcgtgcatata
ttaccgttttttccttacagttcagatgatggcttttctgtgatcgactattctagtgtg
aacgaagcattaggcgattgggaagacatcaaacggatcgcgacagactttaggttaatg
tcagatgtggtaattaaccattgttcttcgcgaagcgcttggtttgataacttcattaag
ggcgaaggaccaggcagcgacttcttctacacggcaagtccagatgaagacttatcaaat
gtggtcaggcctcgtacgtctcctctattacgtgagactgaaacagcaaaaggtatcgag
catgtttggtgcacattcagtcacgatcaagttgattttgattttcgtaatcccaaagtg
ttagaaactttcgtttcaatcattcgtcaatatttggataatggcgtcaggctgttcagg
ctggatgccgtggcttttttatggaaaaaacttggcacaccttgtatcaacttagaacaa
acccatgaagtggtaagattactgcgcacacttattgaacatgcgcagccagatgtgatt
attatcacagaaacgaatataccaaatagagaaaacttagcttaccttggaaatgccaat
gaagctcatgcgatctacaatttctctttgcccccattgttggtaaatactctcattacg
ggtgattgtcattacctgaagtcatggttaatgagcatgcccccagcgcaaaacggcact
acctattttaattttattgcatcccatgatggaatcggcctacgaccagctgaaggctta
ttagaagacgaggagctcacggtactcgtaaacactatgcagaattttggcggcagaatt
tcgtggcgtgcttctgaaaatgggcagcaaaaagcgtatgaaattaatattgcattatat
gacgctcttcaggggacaacgaagggaacggataaatggggcttccagcgttttatgtgc
gcccatgcgattatgcttggtttagaagggatccctgggatctatattcacagtttattg
gctacaggtaatgattacgaacgggttaaaaataccagtcataaccgcgctataaatcgt
cacaaatggcaatatactgaattacagaagcaattagcatcgccctactcccaacaccaa
cgcgtattgaaggccatgggtgagctactcaccatacgccgccagcaggtggcatttcac
cccaacgctacacaatttaccttgcagttaggaagcaaagtatttggtttctggcgtcag
agtatcgatagaagacaaagcatattttgtatcagtaatatttgtgatgagatacaagaa
atacacttaagtgatattaacttagtaggcaccgacgagtggatagacttaatgacgcag
caacccatttatgctgcagacagtttcattgaactagcaccatatcaaacgatgtggatc
agcaatttacctaaacgttaa

DBGET integrated database retrieval system